DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and CG9733

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:391 Identity:123/391 - (31%)
Similarity:168/391 - (42%) Gaps:106/391 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DRSWAVY--------NYKPPSRGYFYPKPERLPPLPVNGSTTSSTGPPPGVQSDFIDDLIEGHKQ 75
            ||::..|        ..:|.|  :.:|:.||.|         .|.|..|                
  Fly    91 DRTFPDYGAFGGDWEEERPQS--FVFPRQERRP---------WSFGNQP---------------- 128

  Fly    76 QILSNVLGVASETPSDTASSLGSTSLSSSASPVFPLEGGGAKAFRVNRCASCTCGVPNVNRIVGG 140
                    ..|.||...:    |||..||..|..|               ||. ||...|||..|
  Fly   129 --------ATSRTPFRKS----STSDGSSLLPQPP---------------SCG-GVGIRNRIYDG 165

  Fly   141 TQVRTNKYPWIAQII------RGTFLFCGGTLINDRYVLTAAHCVHGMDMRG----VSVRLLQLD 195
            .....|::||:..:.      .|....|.|:|||.|||||||||:.|...|.    |||||.:.|
  Fly   166 QDTDVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHCLTGRIEREVGTLVSVRLGEHD 230

  Fly   196 RSSTHLGV------------TRSVAF----AHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPAC 244
               |...|            .:.:.|    .|........:.||||.|:|:::.:...|.::|.|
  Fly   231 ---TRTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQVHDIGLIRMERNVRYSDNIQPIC 292

  Fly   245 LPSN-WLQNFDF-QKAIVAGWGLSQEGGSTSSVLQEVVVPIITNAQCRA--TSYRSMIVDTMMCA 305
            |||: .|::... |:..|||||.:.: .:.|:|.|:|.|..:..|:||.  :..:..:..|.:||
  Fly   293 LPSSVGLESRQSGQQFTVAGWGRTLK-MARSAVKQKVTVNYVDPAKCRQRFSQIKVNLEPTQLCA 356

  Fly   306 GYVKTGG---RDACQGDSGGPLI-VRDRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWIAVNT 366
                 ||   :|:|.|||||||: .||..:.|.|:|||||.|...|.|||||.|:.|..||..|.
  Fly   357 -----GGQFRKDSCDGDSGGPLMRFRDESWVLEGIVSFGYKCGLKDWPGVYTNVAAYDIWIRQNV 416

  Fly   367 R 367
            |
  Fly   417 R 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 92/259 (36%)
Tryp_SPc 137..362 CDD:238113 91/258 (35%)
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 92/259 (36%)
Tryp_SPc 162..415 CDD:238113 93/261 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457372
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.