DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and CG17404

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_650165.2 Gene:CG17404 / 41482 FlyBaseID:FBgn0038001 Length:275 Species:Drosophila melanogaster


Alignment Length:251 Identity:77/251 - (30%)
Similarity:121/251 - (48%) Gaps:27/251 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 NRIVGGTQVRTNKY-PWIAQI---IRGTFL-FCGGTLINDRYVLTAAHCVHGMDMRGVSVRLLQL 194
            :|||||..:...:: |:...:   .||..: ||||::|....:||||||..|::...:||  :..
  Fly    33 HRIVGGADIPPGEHVPYQVSLQYRTRGGQMHFCGGSIIAPNRILTAAHCCQGLNASRMSV--VAG 95

  Fly   195 DRSSTHLGVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLPSNWLQNFDF---- 255
            .|.....|....|.....|..|..: :..|:|:|.:..|:.|.::...|....:  |..||    
  Fly    96 IRGLNEKGSRSQVLSYSIHPKYQEL-VTSDLAVLSIKPPLKLNNSTISAIEYRS--QGKDFVGGG 157

  Fly   256 QKAIVAGWGLS-------QEGGSTSSVLQEVVVPIITNAQCRATSYRSMIVDTMMCAGYVKTGGR 313
            ....:.||||.       .:..:..:|||.:....|:|::||.....| :.||.:||   :...|
  Fly   158 VPVTLTGWGLRLPVPFPFLDNVNYPNVLQRMSYHTISNSECRNAGMES-VTDTEICA---RGPFR 218

  Fly   314 DACQGDSGGPLIVRDRI-FRLAGVVSFG-YGCAKPDAPGVYTRVSRYLEWIAVNTR 367
            .||.|||||||::..:. .:..|:||:| ..|....:|.||||||.:.:||...|:
  Fly   219 GACSGDSGGPLVMESKNGLQQVGIVSYGLVVCGLYISPDVYTRVSTFSDWIGNQTK 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 74/243 (30%)
Tryp_SPc 137..362 CDD:238113 73/242 (30%)
CG17404NP_650165.2 Tryp_SPc 34..269 CDD:214473 74/243 (30%)
Tryp_SPc 35..269 CDD:238113 73/242 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.