DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and Tmprss11c

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:261 Identity:92/261 - (35%)
Similarity:142/261 - (54%) Gaps:21/261 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 AKAFRVNRCASCTCGVPNVNRIVGGTQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHC-V 179
            :.:|:.:.|...|. .|..:::.||......::||.|.:.:.....||.|||::.:::||||| |
  Rat   167 SSSFKFSGCGRRTI-TPGGHKVAGGQDAEEGEWPWQASLQQNNVHRCGATLISNSWLITAAHCFV 230

  Fly   180 HGMDMRGVSVR---LLQLDRSSTHLGVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMR 241
            ...:.:...|.   ||...::.      |:|.....|..|...:..:|||::||..|:...:.:|
  Rat   231 RSANPKDWKVSFGFLLSKPQAQ------RAVKSIVIHENYSYPAHNNDIAVVRLSSPVLYENNIR 289

  Fly   242 PACLP---SNWLQNFDFQKAIVAGWGLSQEGGSTSSVLQEVVVPIITNAQCRA-TSYRSMIVDTM 302
            .||||   ..:..|.|   .:|.|||..:..|.:.::||:..|.||.|..|.: .:|..:|...|
  Rat   290 RACLPEATQKFPPNSD---VVVTGWGTLKSDGDSPNILQKGRVKIIDNKTCNSGKAYGGVITPGM 351

  Fly   303 MCAGYVKTGGRDACQGDSGGPLIVRDR--IFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWIAVN 365
            :|||::: |..|||||||||||:..|.  |:.|||:||:|..||.|:.|||||||:.|.:||:..
  Rat   352 LCAGFLE-GRVDACQGDSGGPLVSEDSKGIWFLAGIVSWGDECALPNKPGVYTRVTHYRDWISSK 415

  Fly   366 T 366
            |
  Rat   416 T 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 85/235 (36%)
Tryp_SPc 137..362 CDD:238113 85/234 (36%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699
Tryp_SPc 186..412 CDD:214473 85/235 (36%)
Tryp_SPc 187..415 CDD:238113 87/237 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 178 1.000 Inparanoid score I3918
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.