DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and CG9372

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster


Alignment Length:290 Identity:108/290 - (37%)
Similarity:166/290 - (57%) Gaps:27/290 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 SSLG----STSLSSSASPVFPLEGGGAKAFRVNRCASCTCGVPN--VNRIVGGTQVRTNKYPWIA 152
            ||:|    ..|.|:..||.......|.:...||:.....||:.:  ..|:.||.....:::||:|
  Fly   125 SSIGICCTDQSTSNRFSPQVVTSADGDEPRIVNKPEQRGCGITSRQFPRLTGGRPAEPDEWPWMA 189

  Fly   153 QIIRG--TFLFCGGTLINDRYVLTAAHCVHGMDMRGVSVRLLQLDRSSTH-LGVTRSVAFAHA-- 212
            .:::.  .|::|||.||.||:|||||||::..:...:.||   |...:|| |..||:..|..|  
  Fly   190 ALLQEGLPFVWCGGVLITDRHVLTAAHCIYKKNKEDIFVR---LGEYNTHMLNETRARDFRIANM 251

  Fly   213 --HVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLP---SNWLQNFDFQKAIVAGWGLSQEGGST 272
              |:.|:|.:..:|||::|:|:.......:.|.|:|   .:|..    :.|||.|||..:.||..
  Fly   252 VLHIDYNPQNYDNDIAIVRIDRATIFNTYIWPVCMPPVNEDWSD----RNAIVTGWGTQKFGGPH 312

  Fly   273 SSVLQEVVVPIITNAQCRATSYRSMIVDTMMCAGYVKTGGRDACQGDSGGPLIVR--DRIFRLAG 335
            |::|.||.:|:...:.|| :|:...:.||.||||:.: ||:|:|||||||||:|:  ::.:...|
  Fly   313 SNILMEVNLPVWKQSDCR-SSFVQHVPDTAMCAGFPE-GGQDSCQGDSGGPLLVQLPNQRWVTIG 375

  Fly   336 VVSFGYGCAKPDAPGVYTRVSRYLEWIAVN 365
            :||:|.||.:...||:||||.|||:||..|
  Fly   376 IVSWGVGCGQRGRPGIYTRVDRYLDWILAN 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 93/237 (39%)
Tryp_SPc 137..362 CDD:238113 92/236 (39%)
CG9372NP_649132.1 CLIP 87..132 CDD:197829 3/6 (50%)
Tryp_SPc 173..402 CDD:214473 93/237 (39%)
Tryp_SPc 176..402 CDD:238113 92/234 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457746
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I2933
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42230
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
65.890

Return to query results.
Submit another query.