DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and CG10663

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster


Alignment Length:275 Identity:92/275 - (33%)
Similarity:135/275 - (49%) Gaps:49/275 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 TCGV----------PNVNRIVGGTQVRTNKYPW-IAQIIRGTFLFCGGTLINDRYVLTAAHCV-- 179
            :||:          .|:.:|:||...|..::|| :|.:.|....|||||||..|:||||||||  
  Fly   488 SCGIVRSGTGRRSMSNMLKIIGGRAARKGEWPWQVAILNRFKEAFCGGTLIAPRWVLTAAHCVRK 552

  Fly   180 --------HGMDMRGVSVRLLQLDRSSTHLGVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPL 236
                    |.::..         |.:...|.|.:|    :.|..:|..::..|:|||||.:.:..
  Fly   553 VLFVRIGEHNLNYE---------DGTEIQLRVMKS----YTHPNFDKRTVDSDVALLRLPKAVNA 604

  Fly   237 VDTMRPACLPSNWL---QNFDFQKAIVAGWGLSQEGGST-SSVLQEVVVPIITNAQCRATSYRSM 297
            ...:..:|||..:.   :|.|   ..:.|||..:...:| :|||.:..||||....||...|...
  Fly   605 TTWIGYSCLPQPFQALPKNVD---CTIIGWGKRRNRDATGTSVLHKATVPIIPMQNCRKVYYDYT 666

  Fly   298 IVDTMMCAGYVKTGGRDACQGDSGGPLIVRDRI-----FRLAGVVSFGYGCAKPDAPGVYTRVSR 357
            |...|.|||:.| |..|.|.|||||||:.||..     :.:.|:.|||.|||:.:..|:|.:|..
  Fly   667 ITKNMFCAGHQK-GHIDTCAGDSGGPLLCRDTTKPNHPWTIFGITSFGDGCAQRNKFGIYAKVPN 730

  Fly   358 YLEWI--AVNTRDSC 370
            |::|:  .||...:|
  Fly   731 YVDWVWSVVNCDGNC 745

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 85/245 (35%)
Tryp_SPc 137..362 CDD:238113 85/244 (35%)
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 85/245 (35%)
Tryp_SPc 507..735 CDD:238113 85/244 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.