DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and CG4477

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_648295.1 Gene:CG4477 / 39058 FlyBaseID:FBgn0035971 Length:315 Species:Drosophila melanogaster


Alignment Length:223 Identity:54/223 - (24%)
Similarity:85/223 - (38%) Gaps:41/223 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 FCGGTLINDRYVLTAAHCVHGMDMRGVSVRLL-----QLDRSS-----------THLGVTRSVAF 209
            ||.|.::...:|:|:|||:.......:|.|:|     .|:|..           ||:.:..|...
  Fly    71 FCSGVILAPMFVMTSAHCLINKRRVLISSRVLLIVAGTLNRLKYIPNRTFVTPVTHIWLPDSFTM 135

  Fly   210 AHAHVGYDPVSLVHDIALLRLDQPIPL----VDTMR-PACLPSNWLQNFDFQKAIVAGWGLSQEG 269
            .:.          .|..||::..|.|.    :...| |...|...|      |..|.|||...:|
  Fly   136 RNK----------QDFGLLKVKNPFPRNNEHISIARLPVHPPLPGL------KCKVMGWGRMYKG 184

  Fly   270 GSTSSVLQEVVVPIITNAQCRATSYRSMIVDTMMCAGYVKTGGRDACQGDSGGPLIVRDRIFRLA 334
            |..:|.:..:.|.:|.:..| |...|...|:.:..........:..|.||.|.|::....::   
  Fly   185 GPLASYMLYIDVQVIDSEAC-AKWLRVPSVEHVCAVDSDDLTAQQPCGGDWGAPMLHNGTVY--- 245

  Fly   335 GVVSFGYGCAKPDAPGVYTRVSRYLEWI 362
            |:|:...||.....|.:||.|.....||
  Fly   246 GIVTILAGCGVSHLPSLYTNVHSNANWI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 52/221 (24%)
Tryp_SPc 137..362 CDD:238113 52/221 (24%)
CG4477NP_648295.1 Tryp_SPc 55..276 CDD:238113 54/223 (24%)
Tryp_SPc 55..273 CDD:214473 52/221 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.