DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and CG6462

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster


Alignment Length:308 Identity:88/308 - (28%)
Similarity:132/308 - (42%) Gaps:56/308 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 ETPSDTAS------SLGSTSLSSSASPVFPLEGGGAKAFRVNRCASCTCGVPNVNRIVGGTQVRT 145
            |||.|..:      .||..:....... |.:||....|.|              .||.||.....
  Fly    36 ETPDDDDAIMERRWQLGYENFRLRCEK-FEMEGNQTAAVR--------------TRIAGGELATR 85

  Fly   146 NKYPW----IAQIIRGTFLFCGGTLINDRYVLTAAHC----VHGMDMRGVSVRLLQLDRSSTHLG 202
            ..:|:    :.|:.....:.|||:||..::|||||||    :......|.:| ...::.|...|.
  Fly    86 GMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYTGATV-FADVEDSVEELQ 149

  Fly   203 VT-RSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLPSNWL-QNFDFQKAI-VAGWG 264
            || |.......::|:...|   |:||:||.:.:...:.::|..|...:: |||...|.: ::|||
  Fly   150 VTHRDFIIYPDYLGFGGYS---DLALIRLPRKVRTSEQVQPIELAGEFMHQNFLVGKVVTLSGWG 211

  Fly   265 -LSQEGGSTSSVLQEVVVPIITNAQC-------RATSYRSMIVDTMMCAGYVKTGGRDACQGDSG 321
             |.......:.:||.:...:|...:|       ..:..|.:..|        .:.||.||.||||
  Fly   212 YLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHLCTD--------GSNGRGACNGDSG 268

  Fly   322 GPLIVRDR-IFRLAGVVSFG--YGCAKPDAPGVYTRVSRYLEWIAVNT 366
            ||::...| :..|.||.|||  .|| :...|.||||::.||.||...|
  Fly   269 GPVVYHWRNVSYLIGVTSFGSAEGC-EVGGPTVYTRITAYLPWIRQQT 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 74/247 (30%)
Tryp_SPc 137..362 CDD:238113 73/246 (30%)
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 74/247 (30%)
Tryp_SPc 77..314 CDD:238113 75/249 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457792
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.840

Return to query results.
Submit another query.