DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and PRSS41

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001382429.1 Gene:PRSS41 / 360226 HGNCID:30715 Length:334 Species:Homo sapiens


Alignment Length:291 Identity:91/291 - (31%)
Similarity:131/291 - (45%) Gaps:62/291 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 GGGAKAF-------RVNRCASCTCGVPNVNRIV-GGTQVRTNKYPWIAQIIRGTFLFCGGTLIND 169
            |||.:..       :.....|..||...::.:| ||.:....::||.|.:.......|||:|::.
Human    39 GGGREGHFLCPAESQEEELLSEACGHREIHALVAGGVESARGRWPWQASLRLRRRHRCGGSLLSR 103

  Fly   170 RYVLTAAHCVH--------------------GMDMRGVSVRLLQLD--RSSTHLGVTRSVAFAHA 212
            |:||:||||..                    ..::|..|.|....|  .:...|||.|       
Human   104 RWVLSAAHCFQKHYYPSEWTVQLGELTSRPTPWNLRAYSSRYKVQDIIVNPDALGVLR------- 161

  Fly   213 HVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLPSNWLQNFDF---QKAIVAGWGLSQEGGSTSS 274
                      :|||||||...:.....::|.|:.|:   .|:|   ....|.||||....|:...
Human   162 ----------NDIALLRLASSVTYNAYIQPICIESS---TFNFVHRPDCWVTGWGLISPSGTPLP 213

  Fly   275 V---LQEVVVPIITNAQC----RATSYRSMIVDTMMCAGYVKTGGRDACQGDSGGPLIV-RDRIF 331
            .   |:|..|.|:.|.:|    ...|.||||.|:|.||| .:.|..|.|:|||||||:. :|.::
Human   214 PPYNLREAQVTILNNTRCNYLFEQPSSRSMIWDSMFCAG-AEDGSVDTCKGDSGGPLVCDKDGLW 277

  Fly   332 RLAGVVSFGYGCAKPDAPGVYTRVSRYLEWI 362
            ...|:||:|..|.:|:.|||||.:|.|..||
Human   278 YQVGIVSWGMDCGQPNRPGVYTNISVYFHWI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 83/259 (32%)
Tryp_SPc 137..362 CDD:238113 83/258 (32%)
PRSS41NP_001382429.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.