DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and CG13744

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster


Alignment Length:269 Identity:91/269 - (33%)
Similarity:130/269 - (48%) Gaps:51/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 CGVPNV------NRIVGGTQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCVHGMDMRGV 187
            ||||..      .||:||...:..:|||.|. ||.....|||.||:...|.|||||:....:..:
  Fly   128 CGVPRTAQNTLQKRIIGGRPAQFAEYPWQAH-IRIAEYQCGGVLISANMVATAAHCIQQAHLADI 191

  Fly   188 SVRLLQLDRSSTHLGVTRSVAFAHAHVGYDPV---------SLVH-------------DIALLRL 230
            :|.|.:||  :..||        |.|   :|:         .::|             |||||:|
  Fly   192 TVYLGELD--TQDLG--------HIH---EPLPVEKHGVLQKIIHPRFNFRMTQPDRYDIALLKL 243

  Fly   231 DQPIPLVDTMRPACLPSNWLQNFDFQKAIVAGWGLSQE--GGSTSSVLQEVVVPIITNAQC---- 289
            .||....:.:.|.|||...::... :|.::||||.::.  |.:.:::||...|||||...|    
  Fly   244 AQPTSFTEHILPICLPQYPIRLIG-RKGLIAGWGKTEAHMGHAGTNMLQVASVPIITTLDCIRWH 307

  Fly   290 RATSYRSMIVDTMMCAGYVKTGGRDACQGDSGGPLIVRDR-IFRLAGVVSFGYGCAKPDAPGVYT 353
            .:......|...|.|||: ..|..|||.|||||||::::| .|.|.|:.|.|:||.....||:|.
  Fly   308 ESKQINVEIKAEMFCAGH-SDGHMDACLGDSGGPLVIKERGRFVLVGITSAGFGCGVDHQPGIYH 371

  Fly   354 RVSRYLEWI 362
            .|.:.:.||
  Fly   372 NVQKTVRWI 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 85/254 (33%)
Tryp_SPc 137..362 CDD:238113 84/253 (33%)
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 85/254 (33%)
Tryp_SPc 142..383 CDD:238113 86/255 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.910

Return to query results.
Submit another query.