DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and CG8738

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster


Alignment Length:237 Identity:73/237 - (30%)
Similarity:119/237 - (50%) Gaps:25/237 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 KYPWIAQI--IRGTFLFCGGTLINDRYVLTAAHCVHGMDMRGVSVRLLQLDRSS---THLGVTRS 206
            ::||:..:  :.|.|: ||||||:.:.|||:||.|.......:.||....|.:|   .|....|:
  Fly   212 EFPWMVALMDMEGNFV-CGGTLIHPQLVLTSAHNVFNRSEDSLLVRAGDWDLNSQTELHPYQMRA 275

  Fly   207 VAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLPSNWLQNFDFQ----KAIVAGWGLSQ 267
            ::..|.|..::.::|.:||||:.|::|..:...::|.|||.......:.:    ..:..||||..
  Fly   276 ISELHRHENFNNLTLYNDIALVVLERPFQVAPHIQPICLPPPETPQMEAELRSASCLATGWGLRY 340

  Fly   268 EGGST-SSVLQEVVVPIITNAQCR------ATSYRSMIVDTMMCAGYVKTGGRDACQGDSGGPLI 325
            ....| .::|:.:.:|.:.:..|:      ....|..:..:..|||.||  |:|.|.||.|.||.
  Fly   341 STSRTMENLLKRIELPAVDHESCQRLLRHTVLGRRYNLHPSFTCAGGVK--GKDTCMGDGGSPLF 403

  Fly   326 V-----RDRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWI 362
            .     :|| ::|.|:||:|..||:.|.|..||.|:....||
  Fly   404 CTLPGQKDR-YQLVGLVSWGIECAEKDVPAAYTNVAYLRNWI 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 71/235 (30%)
Tryp_SPc 137..362 CDD:238113 71/235 (30%)
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 73/237 (31%)
Tryp_SPc 207..444 CDD:214473 71/235 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457474
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.