DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and SPH93

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster


Alignment Length:385 Identity:109/385 - (28%)
Similarity:164/385 - (42%) Gaps:78/385 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 YKPPSRGY------------FYPK-----PERLPPLPVN--GSTTSSTGPPPGVQSDFIDDLIEG 72
            |..|:.||            .||.     |......|||  |...::.|.|              
  Fly   127 YTTPNGGYPVNNGGYPVNNGGYPSNNGGYPSNNGGYPVNNGGYPVNNGGYP-------------- 177

  Fly    73 HKQQILSNVLGVASETPSDTASSLGSTSLSSSASPVF----PLEGGGAKAFRV--NRCASCTCGV 131
                  :|..|..:.......:::|:.: ::..:|..    |...||.....|  :...|.:||:
  Fly   178 ------ANNGGYPANNGGYPTTNVGNPT-NNGGNPTTNFGNPTNNGGNPTTNVGSSELLSPSCGM 235

  Fly   132 PNVN--RIVGG---TQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCVHGMDMRGVSVRL 191
            .|.|  ::|.|   .|.|..:|||...|........||:||....|||.||.|..::...| ||.
  Fly   236 SNANGLQMVEGITIDQARPAQYPWAVAIFHNGQYLAGGSLIQPNVVLTVAHRVITIETELV-VRA 299

  Fly   192 ----LQLDRSSTHLGVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLPS-NWLQ 251
                |:.|| ...|...|.|..|..|.|:|..|..:::|||.|:.|..|.|.:|..|||: |  :
  Fly   300 GDWDLKSDR-EIFLSEQREVERAVIHEGFDFKSGANNLALLFLNSPFKLNDHIRTICLPTPN--K 361

  Fly   252 NFDFQKAIVAGWG-LSQEGGSTSSVLQEVVVPIITNAQC----RAT--SYRSMIVDTMMCAGYVK 309
            :|..::..||||| :..|....|:||::|.:.::....|    |:|  ..:..:...::|||   
  Fly   362 SFAGRRCTVAGWGKMRYEDQRYSTVLKKVQLLVVNRNVCEKFLRSTRLGAKFELPKNIICAG--- 423

  Fly   310 TG--GRDACQGDSGGPLIV-----RDRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWI 362
             |  |||.|.||.|..|..     ...::..||:|::|.||.:...|.:||.||::..||
  Fly   424 -GELGRDTCTGDGGSALFCSIGGENSGVYEQAGIVNWGVGCGQEGIPAIYTEVSKFTNWI 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 81/247 (33%)
Tryp_SPc 137..362 CDD:238113 81/246 (33%)
SPH93NP_609840.1 GRP <136..189 CDD:254089 11/72 (15%)
Tryp_SPc 250..485 CDD:238113 81/241 (34%)
Tryp_SPc 252..482 CDD:214473 78/237 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457692
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.