DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and l(2)k05911

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_723797.3 Gene:l(2)k05911 / 34731 FlyBaseID:FBgn0284244 Length:639 Species:Drosophila melanogaster


Alignment Length:372 Identity:122/372 - (32%)
Similarity:181/372 - (48%) Gaps:71/372 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PPSRGYFYPKPERLPPLPVNGSTTSSTGPPPGVQSDFIDDLIEGHKQQILSNVLGVAS---ETPS 90
            ||:.| .:|     ||||        |.||             .|.........||.|   .||.
  Fly   306 PPTTG-GWP-----PPLP--------THPP-------------NHHYPTHPTTGGVPSTKRTTPR 343

  Fly    91 DTASSLGST----SLSSSASPVF-------PLEGGGAKAFRVNRCASCTCGVPNVNRIVGGTQVR 144
            .|:.:..:|    :..|..|||.       |:.|..::...: :|.:.....|:..|||||....
  Fly   344 PTSPARPTTTRRPTYPSYPSPVTTTTTTRRPVSGTSSEGLPL-QCGNKNPVTPDQERIVGGINAS 407

  Fly   145 TNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCVHGMDMRGVSVRLLQLDRSSTHLG------- 202
            .:::||||.:.:....||||:||.:.::|||||||..|....|:.       .:.|||       
  Fly   408 PHEFPWIAVLFKSGKQFCGGSLITNSHILTAAHCVARMTSWDVAA-------LTAHLGDYNIGTD 465

  Fly   203 -----VTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACL---PSNWLQNFDFQKAI 259
                 |:|.:.....|.|::..:|.:|:|:|.|.:|:|....::|.||   ||...:::..|.|.
  Fly   466 FEVQHVSRRIKRLVRHKGFEFSTLHNDVAILTLSEPVPFTREIQPICLPTSPSQQSRSYSGQVAT 530

  Fly   260 VAGWGLSQEGGSTSSVLQEVVVPIITNAQCRATSYRSM---IVDTMMCAGYVKTGGRDACQGDSG 321
            |||||..:|.|...|:||:|.:||.|||:|.....|:.   |:::|:|||   ...:|:|.||||
  Fly   531 VAGWGSLRENGPQPSILQKVDIPIWTNAECARKYGRAAPGGIIESMICAG---QAAKDSCSGDSG 592

  Fly   322 GPLIVRD-RIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWIAVNTR 367
            ||:::.| ..:...|:||:|.||.|...|||||||:..|.||..|.:
  Fly   593 GPMVINDGGRYTQVGIVSWGIGCGKGQYPGVYTRVTSLLPWIYKNIK 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 92/244 (38%)
Tryp_SPc 137..362 CDD:238113 91/243 (37%)
l(2)k05911NP_723797.3 CLIP 111..174 CDD:197829
Tryp_SPc 399..634 CDD:214473 92/244 (38%)
Tryp_SPc 400..637 CDD:238113 93/246 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 147 1.000 Domainoid score I2768
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
44.010

Return to query results.
Submit another query.