DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and CG40160

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster


Alignment Length:262 Identity:80/262 - (30%)
Similarity:119/262 - (45%) Gaps:35/262 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 CGVPNVNRI------VGGTQVRTNKYPWIAQIIRGTFL--FCGGTLINDRYVLTAAHCVHGMDMR 185
            |||.|...:      |...:....::||...::....|  ||.|:||:.:.||||||||..:...
  Fly   151 CGVRNTGGLDFTLSGVSQNEAGFGEFPWTVALLHSGNLSYFCAGSLIHKQVVLTAAHCVESLRTG 215

  Fly   186 GVSVRLLQLDRSSTHLGV---TRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLPS 247
            ..:||..:.|..:....:   .|||.....|..|:..|:.:|.||:.|.||:.|.|.:...||| 
  Fly   216 SFTVRAGEWDTQTMKERLPYQERSVQTVILHPDYNRRSIAYDFALVILSQPVTLDDHINVICLP- 279

  Fly   248 NWLQNFDFQK----AIVAGWGLSQEG--GSTSSVLQEVVVPII--TNAQCRATSYR---SMIVD- 300
               |..|..:    ....|||....|  |..||:::.|.:||:  .:.|.|....|   ...:| 
  Fly   280 ---QQDDIPQPGNTCFSTGWGKDAFGSLGKYSSLMKRVPLPIVEFNSCQTRLRGTRLGPKFALDR 341

  Fly   301 TMMCAGYVKTGGRDACQGDSGGPLI-----VRDRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLE 360
            :.:|||..:  |.|.||||.|.||.     .|:..::..|:|::|.|| ..:.|..|..|:....
  Fly   342 SFICAGGQR--GIDTCQGDGGAPLACPRGSTRESRYQQTGIVAWGIGC-NDEVPAAYANVALVRG 403

  Fly   361 WI 362
            ||
  Fly   404 WI 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 74/253 (29%)
Tryp_SPc 137..362 CDD:238113 74/252 (29%)
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 76/247 (31%)
Tryp_SPc 169..405 CDD:214473 73/242 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457644
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.