DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and prss60.3

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:278 Identity:98/278 - (35%)
Similarity:147/278 - (52%) Gaps:43/278 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 KAFRVNRCASCT--------------CGVPNVN-RIVGGTQVRTNKYPWIAQIIRGTF--LFCGG 164
            |.:|:. ||:.|              ||...:| |||||.......:||...:....:  .||||
Zfish     2 KMWRLT-CATLTLLICVKGSLSQLNVCGQAPLNTRIVGGVNASPGSWPWQVSLHSPKYGGHFCGG 65

  Fly   165 TLINDRYVLTAAHCVHGMDMRGVSVRLLQLDRSSTHLGVT-RSVAFAHAHVGYDPVSLVHDIALL 228
            :||:..:|||||||:.|:....:.|.|.:..:...::..| |:||.:..|..|:..:..:|||||
Zfish    66 SLISSEWVLTAAHCLSGVSETTLVVYLGRRTQQGINIYETSRNVAKSFVHSSYNSNTNDNDIALL 130

  Fly   229 RLDQPIPLVDTMRPACL----------PSNWLQNFDFQKAIVAGWGLSQEGGS--TSSVLQEVVV 281
            ||...:...:.:||.||          .|:|          :.|||..|.|.:  ...:|||.::
Zfish   131 RLSSAVTFTNYIRPVCLAAQNSVYSAGTSSW----------ITGWGDIQAGVNLPAPGILQETMI 185

  Fly   282 PIITNAQCRATSYRSMIVDTMMCAGYVKTGGRDACQGDSGGPLIVR-DRIFRLAGVVSFGYGCAK 345
            |::.|.:|.|......:.:.|:|||..: ||:|.||||||||::.| ..::..||:.|:|||||.
Zfish   186 PVVANDRCNALLGSGTVTNNMICAGLTQ-GGKDTCQGDSGGPMVTRLCTVWVQAGITSWGYGCAD 249

  Fly   346 PDAPGVYTRVSRYLEWIA 363
            |::||||||||:|..||:
Zfish   250 PNSPGVYTRVSQYQSWIS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 88/241 (37%)
Tryp_SPc 137..362 CDD:238113 87/240 (36%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 89/243 (37%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587889
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.