DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and CG1304

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:244 Identity:78/244 - (31%)
Similarity:116/244 - (47%) Gaps:30/244 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 RIVGGTQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCVHGMDMRGVSV---------RL 191
            |:|||.....|::|....:.......|||::::..|||||||||...|..|.||         |.
  Fly    31 RVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCVTNQDSNGNSVPIAAERFTIRA 95

  Fly   192 LQLDRSSTHLGVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLP-SNWLQNFDF 255
            ...||.|.  ||...||....|..|.  :.::|:|||||:.|:.|..:::|..|| ::...:.| 
  Fly    96 GSNDRFSG--GVLVQVAEVIVHEEYG--NFLNDVALLRLESPLILSASIQPIDLPTADTPADVD- 155

  Fly   256 QKAIVAGWGLSQEGGSTSSVLQEVVVPIITNAQCRATSYRSMI---VDTMMCAGYVKTGGRDACQ 317
              .|::|||..:..|.....||...:..|:..:|     ..:|   |.:.:|..:....|  ||.
  Fly   156 --VIISGWGRIKHQGDLPRYLQYNTLKSISLERC-----DELIGWGVQSELCLIHEADNG--ACN 211

  Fly   318 GDSGGPLIVRDRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWIAVNT 366
            ||||||.:..:::..:||.|....|.:.||.   |.||..:.|||..|:
  Fly   212 GDSGGPAVYNNQVVGVAGFVWSACGTSYPDG---YARVYYHNEWIKNNS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 75/238 (32%)
Tryp_SPc 137..362 CDD:238113 74/237 (31%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 75/238 (32%)
Tryp_SPc 32..256 CDD:238113 76/240 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457768
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.