DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and CG14227

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster


Alignment Length:265 Identity:76/265 - (28%)
Similarity:114/265 - (43%) Gaps:43/265 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 ASCTCGVPNVNRIV------GGTQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCVHGMD 183
            |.|...:|...::.      ..|.::.|  |||..:|......|.|:|||.|:||||||||.   
  Fly    29 AECGRSLPTNAKLTWWNYFDSSTDIQAN--PWIVSVIVNGKAKCSGSLINHRFVLTAAHCVF--- 88

  Fly   184 MRGVSVRLLQLDRSSTHLGVTRSVAFAHA----------HVGYDPV-SLVHDIALLRLDQPIPLV 237
            ...:.|.|...|..:.....:.....::|          |.|:..: :..:||.|||:...:...
  Fly    89 REAMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHAGFGKIQAQQYDIGLLRMQHAVQYS 153

  Fly   238 DTMRPACLPSNW-LQNFD-FQKAIVAGWGLSQEG-GSTSSVLQEVVVPIITNAQCRATSYRSMIV 299
            |.:||.||..|. :...| ||..:   ||.:.|. .|...||:..|...|....| ...::..:.
  Fly   154 DFVRPICLLINEPVAAIDRFQLTV---WGTTAEDFRSIPRVLKHSVGDRIDRELC-TLKFQQQVD 214

  Fly   300 DTMMCAGYVKTGGRDACQGDSGGPLIVR------DRIFRLAGVVSFGY-GCAKPDAPGVYTRVSR 357
            ::.:|   |.|....||:||||||...:      .|.|:. |::.||. .||   ...|.|.|:.
  Fly   215 ESQIC---VHTETSHACKGDSGGPFSAKILYGGTYRTFQF-GIIIFGLSSCA---GLSVCTNVTF 272

  Fly   358 YLEWI 362
            |::||
  Fly   273 YMDWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 71/252 (28%)
Tryp_SPc 137..362 CDD:238113 71/251 (28%)
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 69/233 (30%)
Tryp_SPc 57..277 CDD:238113 69/233 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.