DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and CG4653

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster


Alignment Length:255 Identity:71/255 - (27%)
Similarity:106/255 - (41%) Gaps:39/255 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 TCGVPNVNRIVG--GTQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCV------HGMDM 184
            |.||...:|:..  |:|      |....:.|.....|||.||.::::|||||||      .....
  Fly    20 TLGVVQSSRLPAEVGSQ------PHSISLRRNGVHVCGGALIREKWILTAAHCVSLGGGQQSYPA 78

  Fly   185 RGVSVRLLQLDRSSTHLGVTRSVAFAHAHVGYDPVSLVHDIALLRLD---------QPIPLVDTM 240
            :..:||:..:.|.:....|..|....|.:.........:|:|||.|:         .||.|. |.
  Fly    79 KSYNVRVGSIQRLTGGQLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDLA-TE 142

  Fly   241 RPACLPSNWLQNFDFQKAIVAGWGLSQEGGSTSSVLQEVVVPIITNAQCRATSYRSMIVDTMMCA 305
            |||.          ..:.|.:|||.||..||.|.|||......::.:.|:...|...  :.::|.
  Fly   143 RPAA----------GSQIIFSGWGSSQVDGSLSHVLQVATRQSLSASDCQTELYLQQ--EDLLCL 195

  Fly   306 GYVKTGGRDACQGDSGGPLIVRDRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWIAVN 365
            ..|.......|.||:|.|....:::..:|.....|.|..:||.   |..|:::||||..|
  Fly   196 SPVDEDFAGLCSGDAGAPASYNNQLVGIAAFFVSGCGSEQPDG---YVDVTQHLEWINEN 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 65/242 (27%)
Tryp_SPc 137..362 CDD:238113 64/241 (27%)
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 66/243 (27%)
Tryp_SPc 30..249 CDD:214473 64/240 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457762
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.