DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and CG9676

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster


Alignment Length:253 Identity:85/253 - (33%)
Similarity:116/253 - (45%) Gaps:34/253 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 CTCGVPNVN------RIVGGTQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCVHGMDMR 185
            |..||...|      ||||||:.|..::|....:.|.....|||::|:..||:||||||    .:
  Fly    12 CAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCV----KQ 72

  Fly   186 GVSV---RLLQLDRSSTHL---GVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPAC 244
            |.:|   ..|::...|..|   ||...||....|..|:  |..||:|:|||...:.....:....
  Fly    73 GNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYN--SNGHDVAVLRLRNSLTFNSNIAAIK 135

  Fly   245 L----PSNWLQNFDFQKAIVAGWGLSQEGGSTSSVLQEVVVPIITNAQCRATSYRSMIVDTMMCA 305
            |    |.|      .....::|||...:.|..|:.|..|.|..::...|:.| |...:.:|.||.
  Fly   136 LATEDPPN------DATVDISGWGAISQRGPISNSLLYVQVKALSRESCQKT-YLRQLPETTMCL 193

  Fly   306 GYVKTGGRDACQGDSGGPLIVRDRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWIA 363
            .:.|..|  ||.||||||...:.::..||..|..|.|.|.||.   |.|||:...|||
  Fly   194 LHPKDKG--ACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDG---YERVSKLRNWIA 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 78/235 (33%)
Tryp_SPc 137..362 CDD:238113 77/234 (33%)
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 78/235 (33%)
Tryp_SPc 28..248 CDD:238113 80/237 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457774
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.