DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and CG33160

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster


Alignment Length:246 Identity:82/246 - (33%)
Similarity:126/246 - (51%) Gaps:49/246 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 RIVGG--TQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCVHGMDMRGVSVRLLQLDRSS 198
            ||:||  :.::..||  :.|:.....| |||:|:..|:|:||||||:..:.....:    ...:|
  Fly    33 RIIGGHVSSIKEEKY--LVQVTTSEEL-CGGSLVKPRWVITAAHCVYNKNKNDFKI----YGGAS 90

  Fly   199 THLG---VTRSVAFAHAHVGYDPVSLVHDIALLRLD--------QPIPLVDTMRPACLPSNWLQN 252
            ...|   |.|:|.:......::..:|..|:|.|||:        :.|||.....||         
  Fly    91 NQAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDMIGANIETIPLAAQSVPA--------- 146

  Fly   253 FDFQKAI--VAGWG-LSQEGGSTSSVLQEVVVPIITNAQCRATSYRSM--IVDTMMCAG--YVKT 310
                :|:  |:||| |:.:...|:..:..|:||:.:.|.| .:::|.:  |..:|:||.  |.| 
  Fly   147 ----RALVKVSGWGFLTADATKTAERVHSVLVPMWSRASC-VSAFRGIHRITRSMVCAARLYKK- 205

  Fly   311 GGRDACQGDSGGPLIVRDRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEW 361
               |:|.|||||||:.|.   :|||:||||||||.. .||:||.|....:|
  Fly   206 ---DSCDGDSGGPLVYRG---QLAGIVSFGYGCASA-LPGIYTSVPEIRDW 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 82/246 (33%)
Tryp_SPc 137..362 CDD:238113 81/245 (33%)
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 81/244 (33%)
Tryp_SPc 34..253 CDD:238113 81/245 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.