DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and CG33127

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster


Alignment Length:241 Identity:69/241 - (28%)
Similarity:104/241 - (43%) Gaps:23/241 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 IVGGTQVR-TNKYPWIA--QIIRGTFL-FCGGTLINDRYVLTAAHCVHGM-----DMRGVSVRLL 192
            |:.|..|: .:..|::.  .:.|.|:. .||.::|..|::|||||||..:     |..|..|...
  Fly    41 IIDGYDVQGVDNVPYLVSLSLTRATYTHLCGASIIGKRWLLTAAHCVDELRTFNGDAVGTPVYAG 105

  Fly   193 QLDRSSTHLGVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLPSNWLQNFDFQK 257
            .::||:......|.|.||..|..::..:...:||||.:.:.......::...||.   .|.|:..
  Fly   106 IINRSNVTAAQVRYVDFASTHRSFNGNAGSDNIALLHVSESFEYNARVQQIALPD---INDDYSN 167

  Fly   258 AIVA--GWGLSQ-EGGSTSSVLQEVVVPIITNAQCRATSYRSMIVDTMMCAGYVKTGGRDACQGD 319
            ...|  ||||:. :|...|..||....|::.:..|:........:........|||     |.||
  Fly   168 KTAAAYGWGLTDPDGDEYSKELQYAFAPLLNSTGCKELLPADAPLTAQQVCSQVKT-----CYGD 227

  Fly   320 SGGPLIVRDRI--FRLAGVVSFGY-GCAKPDAPGVYTRVSRYLEWI 362
            .|.|||.....  ..|.|:.|:.| .|...:.|.|||.|..|:.||
  Fly   228 GGTPLIYWPITGPAELVGLGSWSYMPCGYANRPTVYTSVPPYIGWI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 67/239 (28%)
Tryp_SPc 137..362 CDD:238113 67/239 (28%)
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 69/241 (29%)
Tryp_SPc 41..273 CDD:214473 67/239 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.