DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and Tmprss6

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_006242057.1 Gene:Tmprss6 / 315388 RGDID:1307138 Length:811 Species:Rattus norvegicus


Alignment Length:247 Identity:106/247 - (42%)
Similarity:148/247 - (59%) Gaps:17/247 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 CTCGV--PNVNRIVGGTQVRTNKYPWIAQI-IRGTFLFCGGTLINDRYVLTAAHCVHGMDM---R 185
            |.||:  |: :|||||......::||.|.: |||..: |||.||.||:|:|||||.....|   |
  Rat   566 CDCGLQGPS-SRIVGGAMSSEGEWPWQASLQIRGRHI-CGGALIADRWVITAAHCFQEDSMASPR 628

  Fly   186 GVSVRLLQLDRSSTHLG-VTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLPSNW 249
            ..:|.|.::.::|...| |:..|:....|..::..|..:|:|||:||.|:....|:||.|||:. 
  Rat   629 LWTVFLGKMRQNSRWPGEVSFKVSRLFLHPYHEEDSHDYDVALLQLDHPVVYSATVRPVCLPAR- 692

  Fly   250 LQNF--DFQKAIVAGWGLSQEGGSTSSVLQEVVVPIITNAQCRATSYRSMIVDTMMCAGYVKTGG 312
             .:|  ..|...:.|||..:|||..||.||:|.|.:|....|. .:||..:...|:||||.| |.
  Rat   693 -SHFFEPGQHCWITGWGAQREGGPGSSTLQKVDVQLIPQDLCN-EAYRYQVTPRMLCAGYRK-GK 754

  Fly   313 RDACQGDSGGPLIVRDRIFR--LAGVVSFGYGCAKPDAPGVYTRVSRYLEWI 362
            :|||||||||||:.::...|  |||:||:|.||.:|:..||||||:|.:.||
  Rat   755 KDACQGDSGGPLVCKEPSGRWFLAGLVSWGLGCGRPNFFGVYTRVTRVVNWI 806

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 100/234 (43%)
Tryp_SPc 137..362 CDD:238113 99/233 (42%)
Tmprss6XP_006242057.1 SEA 88..185 CDD:279699
LDLa 459..489 CDD:238060
LDLa 495..525 CDD:238060
Ldl_recept_a 529..566 CDD:278486 106/247 (43%)
Tryp_SPc 576..806 CDD:214473 100/234 (43%)
Tryp_SPc 577..809 CDD:238113 101/235 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BJ04
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.