DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and Tmprss3

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_038954650.1 Gene:Tmprss3 / 309665 RGDID:1310135 Length:454 Species:Rattus norvegicus


Alignment Length:314 Identity:106/314 - (33%)
Similarity:170/314 - (54%) Gaps:22/314 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 GPPPGVQSDFIDDLIEGHKQQILSNVLGVASETPSDTASSLGSTSLSSSASPVFPLEGGGAKAFR 120
            |.|..|.||.:  .::..::|...:.:.:....|.|..::|..:        |:..||..:....
  Rat   146 GFPSYVSSDHL--RVDALEEQFQGDFVSINHLLPDDKVTALHHS--------VYMREGCTSGHVV 200

  Fly   121 VNRCASCTCGVPNVNRIVGGTQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCVHGM--- 182
            ..:|::|........|||||......::||...:....:..|||::|...:::||||||:.:   
  Rat   201 TLKCSACGMRTGYSPRIVGGNVSSLTQWPWQVSLQFQGYHLCGGSVITPLWIVTAAHCVYDLYHP 265

  Fly   183 DMRGVSVRLLQLDRSSTHLGVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLPS 247
            ....|.|.|:.|..|.....:...:.:   |..|.|..|.:||||::|.:|:...:|::|.||| 
  Rat   266 KSWTVQVGLVSLMDSPVPSHLVEKIIY---HSKYKPKRLGNDIALMKLSEPLTFDETIQPICLP- 326

  Fly   248 NWLQNF-DFQKAIVAGWGLSQEG-GSTSSVLQEVVVPIITNAQCRATS-YRSMIVDTMMCAGYVK 309
            |..:|| |.:....:|||.:::| |..|.||....||:|:|..|.... |..:|..:|:||||:|
  Rat   327 NSEENFPDGKLCWTSGWGATEDGAGDASPVLNHAAVPLISNKICNHRDVYGGIISPSMLCAGYLK 391

  Fly   310 TGGRDACQGDSGGPLIVRD-RIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWI 362
             ||.|:|||||||||:.:: |:::|.|..|||.|||:.:.||||||::.:|:||
  Rat   392 -GGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRITSFLDWI 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 90/232 (39%)
Tryp_SPc 137..362 CDD:238113 89/231 (39%)
Tmprss3XP_038954650.1 LDLa 74..107 CDD:238060
SRCR_2 112..211 CDD:406055 14/74 (19%)
Tryp_SPc 216..444 CDD:214473 90/232 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H56985
Inparanoid 1 1.050 178 1.000 Inparanoid score I3918
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45531
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.