DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and Prss22

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001100454.1 Gene:Prss22 / 302971 RGDID:1310880 Length:307 Species:Rattus norvegicus


Alignment Length:291 Identity:94/291 - (32%)
Similarity:140/291 - (48%) Gaps:50/291 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 PLEGGG---------------AKAFRVNRCASCTCGVP-NVNRIVGGTQVRTNKYPWIAQIIRGT 158
            ||..||               |.....|...|..||.| .:||:|||......::|||..|::..
  Rat     7 PLALGGDQFRTLILLVLLTSTATVSAANIRGSPDCGKPQQLNRVVGGEDSADAQWPWIVSILKNG 71

  Fly   159 FLFCGGTLINDRYVLTAAHCVHGMDMRGVSVRLLQLDRSSTH---LGVTR-----------SVAF 209
            ...|.|:|:.:|:|::||||...           .:|:.|.:   ||..:           .:|.
  Rat    72 SHHCAGSLLTNRWVVSAAHCFSS-----------NMDKPSPYSVLLGAWKLGNPGPRSQKVGIAS 125

  Fly   210 AHAHVGYDPVSLVH-DIALLRLDQPIPLVDTMRPACLPSNWLQNFDFQKAIVAGWGLSQEGG--S 271
            ...|..|......| ||||:||::||...:.:.|.|||.:.:.........:||||..|:|.  .
  Rat   126 VLPHPRYSRKEGTHADIALVRLERPIQFSERILPICLPDSSVHLPPNTNCWIAGWGSIQDGVPLP 190

  Fly   272 TSSVLQEVVVPIITNAQCRATSYR----SMIVDTMMCAGYVKTGGRDACQGDSGGPLIVR-DRIF 331
            ....||::.||||....|::..:|    ..|.:.|:||||:: |.||||.|||||||:.: |..:
  Rat   191 RPQTLQKLKVPIIDPELCKSLYWRGAGQEAITEDMLCAGYLE-GKRDACLGDSGGPLMCQVDDHW 254

  Fly   332 RLAGVVSFGYGCAKPDAPGVYTRVSRYLEWI 362
            .|.|::|:|.|||:.:.|||||.:..:..|:
  Rat   255 LLTGIISWGEGCAERNRPGVYTSLLAHRPWV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 82/247 (33%)
Tryp_SPc 137..362 CDD:238113 81/246 (33%)
Prss22NP_001100454.1 Tryp_SPc 49..285 CDD:214473 82/247 (33%)
Tryp_SPc 50..288 CDD:238113 82/248 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.