DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and Tpsb2

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_062053.2 Gene:Tpsb2 / 29268 RGDID:3065 Length:274 Species:Rattus norvegicus


Alignment Length:265 Identity:94/265 - (35%)
Similarity:136/265 - (51%) Gaps:51/265 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 CGVPNVNRIVGGTQVRTNKYPWIAQI-IRGTFL----FCGGTLINDRYVLTAAHCVHGMDMRGVS 188
            |.|.....||||.:...:|:||  |: :|..|.    ||||:||:.::|||||||| |:.::...
  Rat    22 CPVKQRVGIVGGREASESKWPW--QVSLRFKFSFWMHFCGGSLIHPQWVLTAAHCV-GLHIKSPE 83

  Fly   189 VRLLQLDRSSTH-----LGVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLP-- 246
            :..:||.....:     |.|.|:|...|.:...|..    |||||.|:.|:.:...:.|..||  
  Rat    84 LFRVQLREQYLYYADQLLTVNRTVVHPHYYTVEDGA----DIALLELENPVNVSTHIHPTSLPPA 144

  Fly   247 --------SNWLQNFDFQKAIVAGWG--LSQEGGSTSSVLQEVVVPIITNAQCRATSYRSM---- 297
                    |.|          |.|||  .|.|.......|::|.|||:.|:.|....:..:    
  Rat   145 SETFPSGTSCW----------VTGWGDIDSDEPLLPPYPLKQVKVPIVENSLCDRKYHTGLYTGD 199

  Fly   298 ----IVDTMMCAGYVKTGGRDACQGDSGGPLIVRDR-IFRLAGVVSFGYGCAKPDAPGVYTRVSR 357
                :.|.|:|||..::   |:|||||||||:.:.: .:..|||||:|.|||:.:.||:||||:.
  Rat   200 DVPIVQDGMLCAGNTRS---DSCQGDSGGPLVCKVKGTWLQAGVVSWGEGCAEANRPGIYTRVTY 261

  Fly   358 YLEWI 362
            ||:||
  Rat   262 YLDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 90/256 (35%)
Tryp_SPc 137..362 CDD:238113 90/255 (35%)
Tpsb2NP_062053.2 Tryp_SPc 30..268 CDD:238113 92/257 (36%)
Tryp_SPc 30..266 CDD:214473 90/255 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346465
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.