DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and Tmprss11g

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001008554.1 Gene:Tmprss11g / 289546 RGDID:1306446 Length:417 Species:Rattus norvegicus


Alignment Length:296 Identity:95/296 - (32%)
Similarity:146/296 - (49%) Gaps:22/296 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 SETPSDTASSLGSTSLSSSASPV-------FPLEGGGAKAFRVNRCASCTCGV----PNVNRIVG 139
            ::|....|.|:.:..|.||.|.:       :..|...|:|..:   .:..||:    |.:.||..
  Rat   127 ADTLRSEADSILNKKLQSSQSFLKRDISLPYLREMNAAQAEHI---LNSNCGLGMEYPRIARIAD 188

  Fly   140 GTQVRTNKYPWIAQI-IRGTFLFCGGTLINDRYVLTAAHCVHGMDMRGVSVRLLQLDRSSTHLGV 203
            |....:|.:||.:.: :.|..| ||.:||..::::|:|||..  :.:...:..:...|:..:...
  Rat   189 GKPAGSNSWPWQSSLQVEGIHL-CGASLIGSQWLVTSAHCFD--NYKNPKLWTVSFGRTLGNPLT 250

  Fly   204 TRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLPSNWLQNFDFQKAIVAGWGLSQE 268
            ||.|.....|..|.......|||:::|..|:...:.:|..|||....|.....|..|.|||..:.
  Rat   251 TRKVESIIIHENYAAHKHDDDIAVVKLSSPVLFSENLRTVCLPEATFQVLPKSKVFVTGWGALKA 315

  Fly   269 GGSTSSVLQEVVVPIITNAQCRATS-YRSMIVDTMMCAGYVKTGGRDACQGDSGGPLIVRD--RI 330
            .|...:.||||.:.||:|..|...: |...|...|:|||:: ||..|||:|||||||::.|  ..
  Rat   316 NGPFPNSLQEVEIEIISNDVCNQVNVYGGAISSGMICAGFL-TGKLDACEGDSGGPLVISDNRNK 379

  Fly   331 FRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWIAVNT 366
            :.|.|:||:|..|.|.:.||:||||:.|..||...|
  Rat   380 WYLLGIVSWGIDCGKENKPGIYTRVTHYRNWIKSKT 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 79/229 (34%)
Tryp_SPc 137..362 CDD:238113 78/228 (34%)
Tmprss11gNP_001008554.1 SEA 48..142 CDD:279699 3/14 (21%)
Tryp_SPc 185..411 CDD:214473 79/229 (34%)
Tryp_SPc 186..414 CDD:238113 80/231 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45531
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.