DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and Prss34

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:259 Identity:97/259 - (37%)
Similarity:129/259 - (49%) Gaps:49/259 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 IVGGTQVRTNKYPWIAQIIRGTFL---------FCGGTLINDRYVLTAAHCVHGMDMRGV----- 187
            ||||..|..:::||...:   .|.         .|||:||:.::||||||||...:|...     
  Rat    33 IVGGCPVSASRFPWQVSL---RFYNMKLSKWEHICGGSLIHPQWVLTAAHCVELKEMEASCFRVQ 94

  Fly   188 --SVRLLQLDRSSTHLGVTRSVAFAH---AHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLPS 247
              .:||.:.|:......:.|...|:.   |..|       .|||||:||..:.|.:.:.|..||:
  Rat    95 VGQLRLYENDQLMKVAKIIRHPKFSEKLSAPGG-------ADIALLKLDSTVVLSERVHPVSLPA 152

  Fly   248 NWLQNFDFQKA-IVAGWGLSQEGG---STSSVLQEVVVPIITNAQCRATSYRS---------MIV 299
            . .|....:|. .|||||:. ||.   .....|:||.|||:.|:.|. ..||:         :|.
  Rat   153 A-SQRISSKKTWWVAGWGVI-EGHRPLPPPCHLREVAVPIVGNSDCE-QKYRTYSSLDRTTKIIK 214

  Fly   300 DTMMCAGYVKTGGRDACQGDSGGPLIVR-DRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWI 362
            |.|:|||   ..|||:||.||||||:.| :..:...||||:|.||..||.|||||||..||.||
  Rat   215 DDMLCAG---MEGRDSCQADSGGPLVCRWNCSWVQVGVVSWGIGCGLPDFPGVYTRVMSYLSWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 95/257 (37%)
Tryp_SPc 137..362 CDD:238113 95/257 (37%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 97/259 (37%)
Tryp_SPc 33..275 CDD:214473 95/257 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.