DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and CG33225

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster


Alignment Length:267 Identity:82/267 - (30%)
Similarity:121/267 - (45%) Gaps:32/267 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 GAKAFRVNRCASCTCGVPNVNRIVGGTQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCV 179
            |:.....|.|.: |.....:.|:|||........||:..::....:||.|:||...:|||:|.|:
  Fly    36 GSSTLLTNDCGT-TRHPSRIRRVVGGNDADRFANPWMVMVLGENNVFCSGSLITRLFVLTSASCL 99

  Fly   180 HGMDMRGVSVRLLQLDRSSTHLGVT--RSV-----AFAHAHVGYDPVSLVHDIALLRLDQPIPLV 237
            ..:..:   |.|.:.||:.|....|  |.|     ...|...|.:.|. .:|||||||.:.:.:.
  Fly   100 LSLPKQ---VILGEYDRNCTSADCTSIRQVIDIDQKIIHGQFGLETVK-KYDIALLRLAKKVSIS 160

  Fly   238 DTMRPACLPSNWLQNFDFQKAIVAGWGLSQEGGSTSSVLQEVVVPIITNAQCRATSYRSMIVDTM 302
            |.:||.||..:.......|.....||| :.|....|::||.|.:..|....|:. ..|..|..:.
  Fly   161 DYVRPICLSVDRQVGRSVQHFTATGWG-TTEWNEPSTILQTVTLSKINRKYCKG-RLRQNIDASQ 223

  Fly   303 MCAGYVKTGGRDACQGDSGGPLIV------------RDRIFRLAGVVSFGYGCAKPDAPGVYTRV 355
            :|.|..:   :|.|.||:||||.:            :.|.| |.|:||  ||.:.....||||.|
  Fly   224 LCVGGPR---KDTCSGDAGGPLSLTLKIDGDGKWNNKSRAF-LIGIVS--YGSSSCSGIGVYTNV 282

  Fly   356 SRYLEWI 362
            ..|::||
  Fly   283 EHYMDWI 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 76/244 (31%)
Tryp_SPc 137..362 CDD:238113 75/243 (31%)
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 76/244 (31%)
Tryp_SPc 57..292 CDD:238113 77/245 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.