DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and CG33226

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:271 Identity:80/271 - (29%)
Similarity:118/271 - (43%) Gaps:56/271 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 CASCTCGVPNVNRIVGGTQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCVHG---MDMR 185
            |.....||.  .:|:||.......:||:.||::..:.||||:||:..:||||||| |.   :.:|
  Fly    36 CVQTPVGVR--EQILGGHNADIKLHPWMVQILQRGYHFCGGSLISSLFVLTAAHC-HSRYRLKVR 97

  Fly   186 -----GVSVRLLQLDRSSTHLGVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACL 245
                 |::.|.|...:..:..|....|.....|..|.... .:||||..|.:|:......||.|:
  Fly    98 FGRYSGITPRYLCSSQYCSPFGPEIDVKRIFLHSSYRDYH-NYDIALFLLAKPVRYNVQTRPICV 161

  Fly   246 PS-----------NWLQNFDFQKAIVAGWGLSQEGGSTSSVLQEVVVPIITNAQCRATSYRSMIV 299
            ..           |::..|:     |.||| ..|...||::||...:..:....| |..:...|.
  Fly   162 LQTSNKDKLRQFLNYVAMFN-----VTGWG-KTESQLTSTILQTTSLFHLDRKFC-AQIFDRKIG 219

  Fly   300 DTMMCAGYVKTGGRDACQGDSGGPL--------IVRDRIFRLAGVVSFGYGCAKPDAPG-----V 351
            ...:|||:.::   ..|.|||||||        :.|..:|   |::|:|       ||.     |
  Fly   220 WPHICAGHSQS---STCTGDSGGPLSAELTFSGVKRTVLF---GIISYG-------APNCREVTV 271

  Fly   352 YTRVSRYLEWI 362
            :|.|.||..||
  Fly   272 FTNVLRYSNWI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 75/257 (29%)
Tryp_SPc 137..362 CDD:238113 75/256 (29%)
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 77/258 (30%)
Tryp_SPc 47..282 CDD:214473 75/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.