DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and CG33226

DIOPT Version :10

Sequence 1:NP_648707.2 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:42 Identity:12/42 - (28%)
Similarity:16/42 - (38%) Gaps:5/42 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 WDLNF---KEDKKPKFHELVLHNLPNMPR--SLWKQLDSYGR 185
            |...|   ..|.:|.....:.|...|.|.  .||.:|.:.||
  Fly   459 WMFKFDRVMHDLQPMLKYRLAHEYGNSPELTELWDRLQNEGR 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_648707.2 Tryp_SPc 136..362 CDD:214473 12/42 (29%)
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.