DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and Tpsg1

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:291 Identity:98/291 - (33%)
Similarity:138/291 - (47%) Gaps:38/291 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 ASETPSDTASSLGSTSLSSSASPVFPLEGGGAKAFRVNRCASCTCGVPNV----NRIVGGTQVRT 145
            |:..|:.:|......||::|.|     .|.|             ||.|.|    :|||||.....
Mouse    49 ATSKPTVSARGQYPDSLANSVS-----SGSG-------------CGHPQVSNSGSRIVGGHAAPA 95

  Fly   146 NKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCVHG-MDMRGVSVRLLQLDRS-STHLGVTRSVA 208
            ..:||.|.:.......|||:|::..:|||||||..| ::.....|.|.:|..: |.|....:.:.
Mouse    96 GTWPWQASLRLHKVHVCGGSLLSPEWVLTAAHCFSGSVNSSDYQVHLGELTVTLSPHFSTVKRII 160

  Fly   209 FAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLPSNWLQNFDFQKAIVAGWGLSQEGGSTS 273
            ......|  |.....||||::|..|:.|...::|.|||......:...:..|.|||.:.||....
Mouse   161 MYTGSPG--PPGSSGDIALVQLSSPVALSSQVQPVCLPEASADFYPGMQCWVTGWGYTGEGEPLK 223

  Fly   274 SV--LQEVVVPIITNAQCRATSYR----SMIVDTMMCAGYVKTGGRDACQGDSGGPLIVR-DRIF 331
            ..  |||..|.::....| :.:|.    |:|...|:||    .|..||||.||||||:.: ...:
Mouse   224 PPYNLQEAKVSVVDVKTC-SQAYNSPNGSLIQPDMLCA----RGPGDACQDDSGGPLVCQVAGTW 283

  Fly   332 RLAGVVSFGYGCAKPDAPGVYTRVSRYLEWI 362
            :.|||||:|.||.:||.||||.||:.|:.||
Mouse   284 QQAGVVSWGEGCGRPDRPGVYARVTAYVNWI 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 83/234 (35%)
Tryp_SPc 137..362 CDD:238113 82/233 (35%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 84/235 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842946
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.