DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and Prss2

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_036861.1 Gene:Prss2 / 25052 RGDID:3418 Length:246 Species:Rattus norvegicus


Alignment Length:255 Identity:89/255 - (34%)
Similarity:140/255 - (54%) Gaps:32/255 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 GGAKAFRVNRCASCTCGVPNVNRIVGGTQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHC 178
            |.|.||.|:          :.::||||...:.|..|:...:..| :.||||:||||::|::||||
  Rat    11 GAAVAFPVD----------DDDKIVGGYTCQENSVPYQVSLNSG-YHFCGGSLINDQWVVSAAHC 64

  Fly   179 VHGMDMRGVSVRLLQ-----LDRSSTHLGVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVD 238
            ....    :.|||.:     |:.:...:...:.:    .|..:|..:|.:||.|::|..|:.|..
  Rat    65 YKSR----IQVRLGEHNINVLEGNEQFVNAAKII----KHPNFDRKTLNNDIMLIKLSSPVKLNA 121

  Fly   239 TMRPACLPSNWLQNFDFQKAIVAGWGLSQEGG-STSSVLQEVVVPIITNAQCRATSYRSMIVDTM 302
            .:....|||:...  ...:.:::|||.:...| :...:||.:..|::..|.|.| ||...|.|.|
  Rat   122 RVATVALPSSCAP--AGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEA-SYPGKITDNM 183

  Fly   303 MCAGYVKTGGRDACQGDSGGPLIVRDRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWI 362
            :|.|::: ||:|:||||||||::...   .|.|:||:|||||.||.|||||:|..|::||
  Rat   184 VCVGFLE-GGKDSCQGDSGGPVVCNG---ELQGIVSWGYGCALPDNPGVYTKVCNYVDWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 82/231 (35%)
Tryp_SPc 137..362 CDD:238113 82/230 (36%)
Prss2NP_036861.1 Tryp_SPc 23..239 CDD:214473 82/231 (35%)
Tryp_SPc 24..242 CDD:238113 84/232 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.