DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and CG30289

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:254 Identity:80/254 - (31%)
Similarity:118/254 - (46%) Gaps:32/254 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 CGV----PNVNRIVGGTQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCVHGMDMRGVSV 189
            ||:    |.|..|.||.:....:.||:  ::..:...|||:||..::||||||||...|:   .|
  Fly    30 CGISKDDPYVPNIFGGAKTNIQENPWM--VLVWSSKPCGGSLIARQFVLTAAHCVSFEDL---YV 89

  Fly   190 RL---LQLDRSSTHLG-------VTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPAC 244
            ||   ..||.....|.       ...||.....|..|:.::|.:||||||:.:.:...|.:||.|
  Fly    90 RLGDYETLDPMPYCLNNHCIPKFYNISVDMKIVHENYNGITLQNDIALLRMSEAVEYSDYVRPIC 154

  Fly   245 -LPSNWLQNFDFQKAIVAGWGLSQEGGSTSSVLQEVVVPIITNAQCRATSYRSMIVDTMMCAGYV 308
             |....:|:...  ..|.||| ..|.|..|.:|....:..:..:.|. ..:......:.:|||  
  Fly   155 LLVGEQMQSIPM--FTVTGWG-ETEYGQFSRILLNATLYNMDISYCN-IKFNKQADRSQICAG-- 213

  Fly   309 KTGGRDACQGDSGGPLIVR----DRIFRLA-GVVSFGYGCAKPDAPGVYTRVSRYLEWI 362
             :...:.|:|||||||..:    :|:.... |:||:|......:..||||.||.:.|||
  Fly   214 -SHTSNTCKGDSGGPLSSKFHYGNRLLSFQYGLVSYGSERCAANVAGVYTNVSYHREWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 74/241 (31%)
Tryp_SPc 137..362 CDD:238113 74/240 (31%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 74/240 (31%)
Tryp_SPc 42..271 CDD:238113 74/240 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.