DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and CG30287

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster


Alignment Length:259 Identity:82/259 - (31%)
Similarity:116/259 - (44%) Gaps:36/259 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 PNVNRIVGGTQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCVHGMDMRGVSVRLLQLDR 196
            |.:.|::.|........||:..||....:.|||:||..|||||||||......: ::|||...|.
  Fly    37 PGLYRVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHCKSETKSQ-LTVRLGDYDV 100

  Fly   197 SST-------------HLGVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACL--- 245
            :..             .:.|||:...:| :..:..    :|||||||:..:...|.:|..||   
  Fly   101 NQAVDCSSYGCIPRPREINVTRTYVPSH-YTNFRK----NDIALLRLETTVQYGDNIRSICLLMG 160

  Fly   246 ----PSNWLQNFDFQKAIVAGWGLSQEGGSTSSVLQEVVVPIITNAQCRATSYRSMIVDTMMCAG 306
                .||.|:|  ..|....|||.: |....|.|||:..:.....:.| |..:...:..:.:|  
  Fly   161 DYTWSSNILKN--LVKFNTTGWGRT-ESRINSPVLQQASLTHHHLSYC-AQVFGKQLDKSHIC-- 219

  Fly   307 YVKTGGRDACQGDSGGPLIVRDRIFRLAGVVSFG---YGCAKPDAPGVYTRVSRYLEWIAVNTR 367
             |.:.....|||||||||..|.||.....|:.||   ||......|.|||.|..:..||.::|:
  Fly   220 -VASSTGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFGPTVYTNVIHFANWIELHTK 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 78/248 (31%)
Tryp_SPc 137..362 CDD:238113 77/247 (31%)
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 78/248 (31%)
Tryp_SPc 42..280 CDD:238113 79/250 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.