DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and CG30025

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster


Alignment Length:254 Identity:92/254 - (36%)
Similarity:139/254 - (54%) Gaps:27/254 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 SCTCG-------VPNVN-RIVGGTQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCVHGM 182
            :|..|       :|.:: |||||:....:.:||...:.|.....|||::.:...::|||||    
  Fly    12 ACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHC---- 72

  Fly   183 DMRGVSVRLLQLDRSSTHL---GVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPAC 244
             ::.||..:||:...|::.   |||.||:....|.||:..::|:|||:::::..:....|::...
  Fly    73 -LQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIG 136

  Fly   245 LPSNWLQNFDFQKAIVAGWG-LSQEGGSTSSVLQEVVVPIITNAQCRATS--YRSMIVDTMMCAG 306
            |.|:...|  ...|.|:||| ||....|..|.||.|.|.|::.:||.:::  |.|.|..||:||.
  Fly   137 LASSNPAN--GAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA 199

  Fly   307 YVKTGGRDACQGDSGGPLIVRDRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWIAVN 365
               ..|:|||||||||||:...   .|.||||:|||||..:.||||..|:....|:..|
  Fly   200 ---ASGKDACQGDSGGPLVSGG---VLVGVVSWGYGCAYSNYPGVYADVAALRSWVINN 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 87/231 (38%)
Tryp_SPc 137..362 CDD:238113 86/230 (37%)
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 87/231 (38%)
Tryp_SPc 31..252 CDD:238113 87/233 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.