DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and TPSD1

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:237 Identity:76/237 - (32%)
Similarity:110/237 - (46%) Gaps:82/237 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 IVGGTQVRTNKYPW-IAQIIRGTFL--FCGGTLINDRYVLTAAHCVHGMDMRGVSVRLLQLDRSS 198
            ||||.:...:|:|| ::..:||.:.  ||||:||:.::||||||||. .|::.::...:||    
Human    38 IVGGQEAPRSKWPWQVSLRVRGPYWMHFCGGSLIHPQWVLTAAHCVE-PDIKDLAALRVQL---- 97

  Fly   199 THLGVTRSVAFAHAHVGYD----PVS--LVH----------DIALLRLDQPI------------P 235
                       ...|:.|.    |||  :||          |||||.|::|:            |
Human    98 -----------REQHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLELEEPVNISSHIHTVTLPP 151

  Fly   236 LVDTMRPACLPSNWLQNFDFQKAIVAGWGLSQEGGSTSSV-------LQEVVVPIITNAQCRA-- 291
            ..:|..|. :|. |          |.||     |...::|       |:||.||::.|..|.|  
Human   152 ASETFPPG-MPC-W----------VTGW-----GDVDNNVHLPPPYPLKEVEVPVVENHLCNAEY 199

  Fly   292 -----TSYRSMIV-DTMMCAGYVKTGGRDACQGDSGGPLIVR 327
                 |.:...|| |.|:|||   :...|:|||||||||:.:
Human   200 HTGLHTGHSFQIVRDDMLCAG---SENHDSCQGDSGGPLVCK 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 76/237 (32%)
Tryp_SPc 137..362 CDD:238113 76/237 (32%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 76/237 (32%)
Tryp_SPc 38..240 CDD:214473 76/237 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152922
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.