DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and try-1

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:269 Identity:96/269 - (35%)
Similarity:136/269 - (50%) Gaps:49/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 CGVPNVN--------------------RIVGGTQVRTNKYPWIAQII-RGTFLFCGGTLINDRYV 172
            ||:.:.|                    |::||::...:.:||..|:: |.....|||:||:..:|
 Worm    30 CGLHSTNVELAQTRSAQEPADYVTLDHRLIGGSESSPHSWPWTVQLLSRLGHHRCGGSLIDPNFV 94

  Fly   173 LTAAHCVHGMDMRGVSVRLLQLDRSSTHLGVTRS-------VAFAHAHVGYD---PVSLVHDIAL 227
            |||||| ...|.|..|.        |..:|..||       |.....|..|:   |.|  :|.|:
 Worm    95 LTAAHC-FAKDRRPTSY--------SVRVGGHRSGSGSPHRVTAVSIHPWYNIGFPSS--YDFAI 148

  Fly   228 LRLDQPIPLVDTMRPACLPSNWLQNFDFQKAIVAGWGLSQEGGSTSS-VLQEVVVPIITNAQCRA 291
            :|:..|:....|.||.||||  |...:.:..:|.|||.:.||.|.|: .|:|:.||:::...|.:
 Worm   149 MRIHPPVNTSTTARPICLPS--LPAVENRLCVVTGWGSTIEGSSLSAPTLREIHVPLLSTLFCSS 211

  Fly   292 -TSYRSMI-VDTMMCAGYVKTGGRDACQGDSGGPLI-VRDRIFRLAGVVSFGYGCAKPDAPGVYT 353
             .:|...| :.:|:|||| ..|..|:|||||||||: .||..:.|.||||:|.|||:|..||||.
 Worm   212 LPNYIGRIHLPSMLCAGY-SYGKIDSCQGDSGGPLMCARDGHWELTGVVSWGIGCARPGMPGVYG 275

  Fly   354 RVSRYLEWI 362
            .|.....||
 Worm   276 NVHSASTWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 91/240 (38%)
Tryp_SPc 137..362 CDD:238113 90/239 (38%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 92/240 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 147 1.000 Domainoid score I2768
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I2933
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.