DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and Tpsb2

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:255 Identity:87/255 - (34%)
Similarity:129/255 - (50%) Gaps:47/255 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 IVGGTQVRTNKYPWIAQI---IRGTFLFCGGTLINDRYVLTAAHCVHGMDMRGVSVRLLQLDRSS 198
            ||||.:...:|:||...:   :.....||||:||:.::|||||||| |..::...:..:||....
Mouse    32 IVGGHEASESKWPWQVSLRFKLNYWIHFCGGSLIHPQWVLTAAHCV-GPHIKSPQLFRVQLREQY 95

  Fly   199 THLG-----VTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLP----------SN 248
            .:.|     :.|.|...|.:......    |:|||.|:.|:.:...:.|..||          |.
Mouse    96 LYYGDQLLSLNRIVVHPHYYTAEGGA----DVALLELEVPVNVSTHLHPISLPPASETFPPGTSC 156

  Fly   249 WLQNFDFQKAIVAGWG--LSQEGGSTSSVLQEVVVPIITNAQCRATSYRSM--------IVDTMM 303
            |          |.|||  .:.|.......|::|.|||:.|:.|....:..:        :.|.|:
Mouse   157 W----------VTGWGDIDNDEPLPPPYPLKQVKVPIVENSLCDRKYHTGLYTGDDFPIVHDGML 211

  Fly   304 CAGYVKTGGRDACQGDSGGPLIVRDR-IFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWI 362
            |||..:   ||:|||||||||:.:.: .:..|||||:|.|||:|:.||:||||:.||:||
Mouse   212 CAGNTR---RDSCQGDSGGPLVCKVKGTWLQAGVVSWGEGCAQPNKPGIYTRVTYYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 85/253 (34%)
Tryp_SPc 137..362 CDD:238113 85/253 (34%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 87/255 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842980
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.