DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and TMPRSS6

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001275929.1 Gene:TMPRSS6 / 164656 HGNCID:16517 Length:824 Species:Homo sapiens


Alignment Length:271 Identity:101/271 - (37%)
Similarity:148/271 - (54%) Gaps:43/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 CTCGV--PNVNRIVGGTQVRTNKYPWIAQI-IRGTFLFCGGTLINDRYVLTAAHCVHGMDMRGV- 187
            |.||:  |: :|||||......::||.|.: :||..: |||.||.||:|:|||||.....|... 
Human   557 CDCGLQGPS-SRIVGGAVSSEGEWPWQASLQVRGRHI-CGGALIADRWVITAAHCFQEDSMASTV 619

  Fly   188 --SVRLLQLDRSSTHLG-VTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLPSNW 249
              :|.|.::.::|...| |:..|:....|..::..|..:|:|||:||.|:.....:||.|||:  
Human   620 LWTVFLGKVWQNSRWPGEVSFKVSRLLLHPYHEEDSHDYDVALLQLDHPVVRSAAVRPVCLPA-- 682

  Fly   250 LQNFDFQKAI---VAGWGLSQEG----------------GS------TSSVLQEVVVPIITNAQC 289
             ::..|:..:   :.|||..:||                ||      .|:.||:|.|.:|....|
Human   683 -RSHFFEPGLHCWITGWGALREGALRADAVALFYGWRNQGSETCCCPISNALQKVDVQLIPQDLC 746

  Fly   290 RATSYRSMIVDTMMCAGYVKTGGRDACQGDSGGPLIVR---DRIFRLAGVVSFGYGCAKPDAPGV 351
             :..||..:...|:||||.| |.:|||||||||||:.:   .|.| |||:||:|.||.:|:..||
Human   747 -SEVYRYQVTPRMLCAGYRK-GKKDACQGDSGGPLVCKALSGRWF-LAGLVSWGLGCGRPNYFGV 808

  Fly   352 YTRVSRYLEWI 362
            |||::..:.||
Human   809 YTRITGVISWI 819

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 95/258 (37%)
Tryp_SPc 137..362 CDD:238113 94/257 (37%)
TMPRSS6NP_001275929.1 SEA 77..177 CDD:307516
CUB 326..440 CDD:238001
LDLa 450..480 CDD:238060
LDLa 486..516 CDD:238060
Ldl_recept_a 520..557 CDD:278486 101/271 (37%)
Tryp_SPc 568..822 CDD:238113 96/259 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BJ04
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40976
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.