DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and Tmprss3

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001157248.1 Gene:Tmprss3 / 140765 MGIID:2155445 Length:475 Species:Mus musculus


Alignment Length:313 Identity:105/313 - (33%)
Similarity:169/313 - (53%) Gaps:21/313 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 GPPPGVQSDFIDDLIEGHKQQILSNVLGVASETPSDTASSLGSTSLSSSASPVFPLEGGGAKAFR 120
            |.|..|.||.:  .::..::|...:.:.:......|..::|..:        |:..||..:....
Mouse   168 GFPSYVSSDHL--RVDALEEQFQGDFVSINHLLSDDKVTALHHS--------VYMREGCTSGHVV 222

  Fly   121 VNRCASCTCGVPNVNRIVGGTQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCVHGM--- 182
            ..:|::|........|||||......::||...:....:..|||::|...:::||||||:.:   
Mouse   223 TLKCSACGTRTGYSPRIVGGNMSSLTQWPWQVSLQFQGYHLCGGSIITPLWIVTAAHCVYDLYHP 287

  Fly   183 DMRGVSVRLLQLDRSSTHLGVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLPS 247
            ....|.|.|:.|..|.....:...:.:   |..|.|..|.:||||::|.:|:...:|::|.||| 
Mouse   288 KSWTVQVGLVSLMDSPVPSHLVEKIIY---HSKYKPKRLGNDIALMKLSEPLTFDETIQPICLP- 348

  Fly   248 NWLQNF-DFQKAIVAGWGLSQEGGSTSSVLQEVVVPIITNAQCRATS-YRSMIVDTMMCAGYVKT 310
            |..:|| |.:....:|||.:::||..|.||....||:|:|..|.... |..:|..:|:||||:| 
Mouse   349 NSEENFPDGKLCWTSGWGATEDGGDASPVLNHAAVPLISNKICNHRDVYGGIISPSMLCAGYLK- 412

  Fly   311 GGRDACQGDSGGPLIVRD-RIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWI 362
            ||.|:|||||||||:.:: |:::|.|..|||.|||:.:.||||||::.:|:||
Mouse   413 GGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRITSFLDWI 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 90/231 (39%)
Tryp_SPc 137..362 CDD:238113 89/230 (39%)
Tmprss3NP_001157248.1 LDLa 96..129 CDD:238060
SRCR_2 134..233 CDD:292133 13/74 (18%)
Tryp_SPc 238..465 CDD:214473 90/231 (39%)
Tryp_SPc 239..468 CDD:238113 91/232 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H56985
Inparanoid 1 1.050 179 1.000 Inparanoid score I3996
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm11120
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.