DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and F10

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001229297.1 Gene:F10 / 14058 MGIID:103107 Length:493 Species:Mus musculus


Alignment Length:355 Identity:108/355 - (30%)
Similarity:166/355 - (46%) Gaps:74/355 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GYFYPKPERLPPLPVNGSTTSSTGPPPGVQSDFIDDLIEGHKQQILSNVLGVASETPSDTA---- 93
            |||         |..:|.:..||.|.|      ...:..|.:::      .||..| ||:.    
Mouse   166 GYF---------LGNDGKSCISTAPFP------CGKITTGRRKR------SVALNT-SDSELDLE 208

  Fly    94 -SSLGSTSLSSSASPVFPLEGGGAKAFRVNRCASCTCGVPNVNRIVGGTQVRTNKYPWIAQII-- 155
             :.|....||.:.:|:..|.....:..|.:         .::.|||||.:.:..:.||.|.:|  
Mouse   209 DALLDEDFLSPTENPIELLNLNETQPERSS---------DDLVRIVGGRECKDGECPWQALLINE 264

  Fly   156 --RGTFLFCGGTLINDRYVLTAAHCVHGMDMRGVSVRLLQLDRSSTHLG-----------VTRSV 207
              .|   |||||::|:.|:||||||:|            |..|....:|           :...|
Mouse   265 DNEG---FCGGTILNEFYILTAAHCLH------------QARRFKVRVGDRNTEKEEGNEMVHEV 314

  Fly   208 AFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLP-SNWLQN--FDFQKAIVAGWGLSQEG 269
            .....|..:...:..:|||:|||..||.....:.||||| .:|.::  ...:..||:|:|.:.|.
Mouse   315 DVVIKHNKFQRDTYDYDIAVLRLKTPITFRMNVAPACLPQKDWAESTLMTQKTGIVSGFGRTHEK 379

  Fly   270 GSTSSVLQEVVVPIITNAQCR-ATSYRSMIVDTMMCAGYVKTGGRDACQGDSGGPLIVR-DRIFR 332
            |..|::|:.:.||.:....|: :||:  .|...|.|||| :....||||||||||.:.| ...:.
Mouse   380 GRQSNILKMLEVPYVDRNTCKLSTSF--SITQNMFCAGY-EAKLEDACQGDSGGPHVTRFKNTYY 441

  Fly   333 LAGVVSFGYGCAKPDAPGVYTRVSRYLEWI 362
            :.|:||:|.|||:....|:||:|:.:|:||
Mouse   442 VTGIVSWGEGCARKGKYGIYTKVTTFLKWI 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 85/245 (35%)
Tryp_SPc 137..362 CDD:238113 84/244 (34%)
F10NP_001229297.1 GLA 36..97 CDD:214503
EGF_CA 98..134 CDD:238011
FXa_inhibition 141..176 CDD:291342 5/18 (28%)
Tryp_SPc 243..471 CDD:214473 85/245 (35%)
Tryp_SPc 244..473 CDD:238113 86/246 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm11114
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.