DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and Prss28

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:249 Identity:78/249 - (31%)
Similarity:116/249 - (46%) Gaps:33/249 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 IVGGTQVRTNKYPWIAQI------IRGTFLFCGGTLINDRYVLTAAHCVHGMD----MRGVSVRL 191
            ||||......|:||...:      :......|||::|:.:::||||||:...|    :..|.|..
Mouse    31 IVGGQCTPPGKWPWQVSLRMYSYEVNSWVHICGGSIIHPQWILTAAHCIQSQDADPAVYRVQVGE 95

  Fly   192 LQLDRSSTHLGVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLPSNWLQNFD-F 255
            :.|.:....|.::|.:    .|..|:.||...|:||::|...:.....:.|..||.: ...|| .
Mouse    96 VYLYKEQELLNISRII----IHPDYNDVSKRFDLALMQLTALLVTSTNVSPVSLPKD-SSTFDST 155

  Fly   256 QKAIVAGWG--LSQEGGSTSSVLQEVVVPIITNAQCRATSYRS---------MIVDTMMCAGYVK 309
            .:..:.|||  |.:........|.||.:||..|..|: .:||.         .|.|.|:|||   
Mouse   156 DQCWLVGWGNLLQRVPLQPPYQLHEVKIPIQDNKSCK-RAYRKKSSDEHKAVAIFDDMLCAG--- 216

  Fly   310 TGGRDACQGDSGGPLIV-RDRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWI 362
            |.||..|.|||||||:. :...:...||||.|..|:. :.|.:::||...|.||
Mouse   217 TSGRGPCFGDSGGPLVCWKSNKWIQVGVVSKGIDCSN-NLPSIFSRVQSSLAWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 76/247 (31%)
Tryp_SPc 137..362 CDD:238113 76/247 (31%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 78/249 (31%)
Tryp_SPc 31..269 CDD:214473 76/247 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843004
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.