DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and LOC101884131

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_017209773.1 Gene:LOC101884131 / 101884131 -ID:- Length:293 Species:Danio rerio


Alignment Length:321 Identity:85/321 - (26%)
Similarity:135/321 - (42%) Gaps:79/321 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 DTASSLGSTSLSSSASPVFP-------LEGGGAKAFRVNRCAS-----CTCGVPNVNRIVGGTQV 143
            :|.|::.:...|:|.|.:..       .|..|.:|...:|..|     ..||:|:|....|...:
Zfish     6 NTDSTISARGFSASLSFISEKDLRETVYEDQGEEADDDSRVISPHLQAALCGMPDVTDASGLDGL 70

  Fly   144 RT----NKYPWI--AQIIRGTFLFCGGTLINDRYVLTAAHCVHGMDMRGVSVRLLQLDRSSTHLG 202
            ::    .|.||:  ..|...:...|.|.:|..:::||.||||:.:|     .|||::...:.| |
Zfish    71 KSAEDDGKVPWLWHVSISLDSGHHCNGVIIQAQWILTNAHCVNDLD-----ERLLRILSVTAH-G 129

  Fly   203 V---TRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLPSNWLQNFDFQKAIVAGWG 264
            :   ||.|.....:..::..||.:::|||:|..|:.|....:||||||             ||  
Zfish   130 LNKQTREVFRVFVNPQFNSSSLDYNVALLQLSSPLNLSGRTQPACLPS-------------AG-- 179

  Fly   265 LSQE------------GGSTSSVLQEVVVPIITNAQCRATSYRSMIVDTMMCAGYVKTGGRDACQ 317
              ||            .|..|...|.:.:.::..|.|. ...|:.:..|::|||        ...
Zfish   180 --QEIPPSLQCWTPVWTGQMSGHEQWLKISVMERAVCE-QHQRTRLTPTLLCAG--------LSS 233

  Fly   318 GDSGGPLIVRDRIFRL---AGVVSFG-------YGCAKPDAPGVYTRVSRYLEWIA--VNT 366
            ||||.|......::.|   :|||..|       ||..:  .|.||:.|...:.||:  :||
Zfish   234 GDSGVPYWNSGSLYCLTNTSGVVLMGLKSWGETYGGTQ--KPAVYSSVPATMHWISQMLNT 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 67/256 (26%)
Tryp_SPc 137..362 CDD:238113 67/255 (26%)
LOC101884131XP_017209773.1 Tryp_SPc 75..288 CDD:238113 68/246 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.