DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and LOC101734975

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_004918402.1 Gene:LOC101734975 / 101734975 -ID:- Length:251 Species:Xenopus tropicalis


Alignment Length:230 Identity:87/230 - (37%)
Similarity:125/230 - (54%) Gaps:21/230 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 PWIAQIIRGTFLFCGGTLINDRYVLTAAHCVHG----MDMRGVSVRLLQLDRSSTHLGVTRSVAF 209
            ||...:.:.....|||:|||:::.::||||..|    .|.: |::...||   |...|:...||.
 Frog     6 PWQLSLRKLGLHICGGSLINNQWAISAAHCFAGPIRVSDYK-VNLGAYQL---SVPSGIFVDVAA 66

  Fly   210 AHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLPSNWLQNFDFQKAIVAGWGLSQEGGST-- 272
            .:.|..:.....:.||||::|..|:...|.:.|.|:|:..:...|....||:|||...:..|.  
 Frog    67 VYVHPTFKGAGSIGDIALIKLANPVQFTDYIIPVCIPTQNVVFPDGMNCIVSGWGTINQQVSLPY 131

  Fly   273 SSVLQEVVVPIITNAQC---------RATSYRSMIVDTMMCAGYVKTGGRDACQGDSGGPLIVR- 327
            ...||:|.||||..|.|         ....|:|:|:..|:|||| |.|.|.:|||||||||:.. 
 Frog   132 PKTLQKVRVPIIGRASCDQMYHINNPTLPPYQSIIMWDMICAGY-KAGRRGSCQGDSGGPLVCPW 195

  Fly   328 DRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWI 362
            :..:.|||:||:|:|||:|:.|||||.|..|..||
 Frog   196 NGSWLLAGIVSWGFGCAQPNKPGVYTSVPAYSAWI 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 85/228 (37%)
Tryp_SPc 137..362 CDD:238113 85/228 (37%)
LOC101734975XP_004918402.1 Tryp_SPc 2..232 CDD:238113 87/230 (38%)
Tryp_SPc 2..230 CDD:214473 85/228 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.