DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and tmprss2.14

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_031752402.1 Gene:tmprss2.14 / 101731505 XenbaseID:XB-GENE-22065937 Length:504 Species:Xenopus tropicalis


Alignment Length:294 Identity:101/294 - (34%)
Similarity:154/294 - (52%) Gaps:24/294 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 TASSLGSTSLS-SSASPVFPLEGGGAKAFRVN----------------RCASCTCGVPNVNRIVG 139
            |::...|:.|| ||::..|.|:.........|                ||.||.......:||||
 Frog   203 TSTYYESSHLSASSSNGYFMLQSSTVTGKLYNHLHYSATCASGNMVSLRCISCGLSTKVDSRIVG 267

  Fly   140 GTQVRTNKYPWIAQIIR--GTFLF-CGGTLINDRYVLTAAHCVHGMDMRGVSVRLLQLDRS-STH 200
            ||......:||..|:::  |..|: |||::|...:|:||||||:|......:.::.....: .::
 Frog   268 GTVASAGDWPWQVQLLKRVGASLYLCGGSIITQHWVVTAAHCVYGSTSTPSAFKVFAGSLTIQSY 332

  Fly   201 LGVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLPSNWLQNFDFQKAIVAGWGL 265
            .....:|..|..|..|...:..:|:|||:|...:.....:||.|||:..:...:.|...::|||.
 Frog   333 YSAGYTVERALVHPSYSSYTQNYDVALLKLTAALVFTTNLRPVCLPNVGMPWAEGQPCWISGWGT 397

  Fly   266 SQEGGSTSSVLQEVVVPIITNAQC-RATSYRSMIVDTMMCAGYVKTGGRDACQGDSGGPLIVR-D 328
            :..|||.|:.|:...||:|::|.| :|..|...|..|||||||: :||.|.|||||||||:.: :
 Frog   398 TSNGGSISTNLKAASVPLISSATCNQAAVYGGAISPTMMCAGYL-SGGTDTCQGDSGGPLVTKTN 461

  Fly   329 RIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWI 362
            .::.|.|..|:||||...:.||||..::..||||
 Frog   462 SLWWLVGDTSWGYGCGMTNKPGVYGNLTFSLEWI 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 86/231 (37%)
Tryp_SPc 137..362 CDD:238113 85/230 (37%)
tmprss2.14XP_031752402.1 LDLa <96..121 CDD:238060
LDLa 128..159 CDD:238060
SRCR_2 164..259 CDD:406055 13/55 (24%)
Tryp_SPc 265..497 CDD:238113 87/232 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.