DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and Tpsab1

DIOPT Version :10

Sequence 1:NP_648707.2 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_112464.4 Gene:Tpsab1 / 100503895 MGIID:96943 Length:273 Species:Mus musculus


Alignment Length:72 Identity:16/72 - (22%)
Similarity:29/72 - (40%) Gaps:11/72 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DRTNRSALISDYLNPYASKSKPKMIHLP---FFTPMYSGQTEVVCNVAMSSPPPDQDDDHEDWVV 92
            :::..|.|:|...:..:.:....:.|.|   .|:||....:....|||.||        ...|.:
Mouse   186 NQSKNSQLLSQLYHTQSRRFGGPVHHQPQRFRFSPMSVDHSVSSMNVASSS--------SSGWCI 242

  Fly    93 GIKFLGR 99
            .:..||:
Mouse   243 FVYNLGQ 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_648707.2 Tryp_SPc 136..362 CDD:214473
Tpsab1NP_112464.4 Tryp_SPc 29..266 CDD:238113 16/72 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.