DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and LOC100497505

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_002940490.1 Gene:LOC100497505 / 100497505 -ID:- Length:308 Species:Xenopus tropicalis


Alignment Length:268 Identity:91/268 - (33%)
Similarity:127/268 - (47%) Gaps:29/268 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 CGVP-----NVNRIVGGTQVRTNKYPWIAQI---IRGTFLF---CGGTLINDRYVLTAAHCVH-G 181
            |||.     ...|||.|.:||...:||...:   .||...:   ||||||:..::||||||.. |
 Frog    38 CGVSFFQQNTAGRIVSGNEVRPYSWPWQVSLQVRPRGGKKYVHVCGGTLIHKSWILTAAHCFQKG 102

  Fly   182 MDMRGVSVRLLQLDRSSTHLGVTRSV-----AFAHAHVGYDPVS-LVHDIALLRLDQPIPLVDTM 240
            ......:.|::....:......|..|     .:.|....|..:: |.:||||::..:.|.....:
 Frog   103 KAEDAANWRIVVGKHNLNRTEATEKVYSVKRIYRHERFSYPQLNDLDYDIALVKPAEDIITTHFI 167

  Fly   241 RPACLPSNWLQNFDFQKAIVAGWGLSQEGG----STSSVLQEVVVPIITNAQCRATSY-RSMIVD 300
            ..||||...:.........|.||| ...||    :.|.||.:..:|||....||...: ...|.:
 Frog   168 HYACLPKKEMAMHPGHFCWVTGWG-DTRGGQGNVTLSEVLNQARLPIIDTKTCRHKKFWGDRIRE 231

  Fly   301 TMMCAGYVKTGGRD-ACQGDSGGPLIVRDRIFR--LAGVVSFG-YGCAKPDAPGVYTRVSRYLEW 361
            :|:|||:...||.. ||||||||||:.:|...|  :.|:|||| .||...:.|.|:|:.|.|:.|
 Frog   232 SMICAGFRNVGGPPAACQGDSGGPLVCQDGRGRWEVHGIVSFGPVGCTVENKPSVFTKTSTYIPW 296

  Fly   362 I-AVNTRD 368
            | |...||
 Frog   297 IEATRIRD 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 83/247 (34%)
Tryp_SPc 137..362 CDD:238113 82/246 (33%)
LOC100497505XP_002940490.1 Tryp_SPc 51..300 CDD:238113 84/249 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.