DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and prss8l.5 loc108703873

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_002939739.1 Gene:prss8l.5 loc108703873 / 100494289 XenbaseID:XB-GENE-22167980 Length:353 Species:Xenopus tropicalis


Alignment Length:261 Identity:91/261 - (34%)
Similarity:134/261 - (51%) Gaps:33/261 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 ASCTCGVPNVN-RIVGGTQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCVHGMDMRGV- 187
            |...||...|: ||:||...:...:||...|....|.||||:||..::|::|:||.:..:.... 
 Frog    23 AVAQCGTRQVSTRIMGGQDSQQGMWPWQVNIRSNDFSFCGGSLITSKWVISASHCFNRTNPPSFY 87

  Fly   188 -----SVRLLQLDRSSTHLGVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLPS 247
                 |.:|...:.:...:.:.|.:    .|..|......|||.|:.|...:...:.::|.||||
 Frog    88 TVYLGSYQLTGANGNEIPMAIQRFI----VHPNYTSPEYGHDITLVELSSDVNFTNYIQPVCLPS 148

  Fly   248 NWLQNFDFQKAI---VAGWG--LSQEGGSTSSVLQEVVVPIITNAQCRA----------TSYRSM 297
               ...:|...:   |.|||  .|.......:.||:|.||:|.|.||.:          :|:  .
 Frog   149 ---AGVNFPTGLQCWVTGWGNIASNVSLRDPNTLQQVAVPLIGNQQCNSILQAPSPLGPSSF--A 208

  Fly   298 IVDTMMCAGYVKTGGRDACQGDSGGPLI-VRDRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEW 361
            |::.|:||||: .||:|:|||||||||: .....:.|.||||||.||.:|:.||||.||:.||:|
 Frog   209 ILNDMLCAGYI-DGGKDSCQGDSGGPLVCAAANQWYLVGVVSFGDGCGQPNRPGVYVRVTAYLDW 272

  Fly   362 I 362
            |
 Frog   273 I 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 85/247 (34%)
Tryp_SPc 137..362 CDD:238113 84/246 (34%)
prss8l.5 loc108703873XP_002939739.1 Tryp_SPc 35..273 CDD:214473 85/247 (34%)
Tryp_SPc 36..275 CDD:238113 86/248 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.