DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and tmprss3

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_031752328.1 Gene:tmprss3 / 100490444 XenbaseID:XB-GENE-994580 Length:483 Species:Xenopus tropicalis


Alignment Length:316 Identity:108/316 - (34%)
Similarity:170/316 - (53%) Gaps:28/316 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 SDFIDDL---IEGHKQQILSNVLGVASETPSDTASSLGSTSLSSSASPVFPLEGGGAKAFRVNRC 124
            |.::..:   :|..::|...:.:.|   |||...:  |.|||....  :.|.|...:......:|
 Frog   172 SSYVSSIYLPVEAVEEQFRRHFVSV---TPSPKFA--GQTSLLQQL--INPSEYCSSGNVITLKC 229

  Fly   125 ASCTCGV-PNVN---RIVGGTQVRTNKYPWIAQII-RGTFLFCGGTLINDRYVLTAAHCVHGMDM 184
            .  .||: |:..   |||||......::||.|.:: :|..| |||:||..::::||||||:  |:
 Frog   230 V--VCGLRPSYTSSARIVGGNVSAVGQWPWQASLVFQGVHL-CGGSLITPQWIVTAAHCVY--DL 289

  Fly   185 ---RGVSVRLLQLDRSSTHLGVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLP 246
               ....|::.|:.::|........|.....|..|...::.:||||:||..|.....:::|.|||
 Frog   290 LYPEWWRVQVGQVSQASESAQTAVPVQKIIYHSKYRSSTMANDIALIRLASPFTFNGSIQPICLP 354

  Fly   247 SNWLQNFDFQKAI-VAGWGLSQEGGSTSSVLQEVVVPIITNAQCRAT-SYRSMIVDTMMCAGYVK 309
             |:.::|...|.. ::|||.::|||.||..:....||:|:|..|... .|..:|..:|:|||:::
 Frog   355 -NYREDFPEGKICWISGWGATEEGGDTSQTMDYAGVPLISNRVCNTKYIYGGVIKPSMVCAGFLE 418

  Fly   310 TGGRDACQGDSGGPLIVRD-RIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWIAV 364
             ||.|.|||||||||...| .:::|.|..|:|.|||....||||||:|.:|:||.:
 Frog   419 -GGVDTCQGDSGGPLACEDSNVWKLMGTTSWGIGCALRYKPGVYTRISSFLDWIHI 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 89/232 (38%)
Tryp_SPc 137..362 CDD:238113 88/231 (38%)
tmprss3XP_031752328.1 LDLa 96..128 CDD:197566
SRCR_2 136..236 CDD:406055 16/72 (22%)
Tryp_SPc 244..472 CDD:238113 89/232 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H56985
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.