DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and plaua

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_017214157.1 Gene:plaua / 100008445 ZFINID:ZDB-GENE-090313-278 Length:421 Species:Danio rerio


Alignment Length:276 Identity:96/276 - (34%)
Similarity:138/276 - (50%) Gaps:58/276 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 TCGVPNVNR---IVGGTQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCVHGMDMRGVSV 189
            |||...::|   |:||.:......||:|.|.:|....||||||...:|||||||.       .:.
Zfish   152 TCGERRLDRQTKIIGGLRSTVESQPWMAAIFKGDGFICGGTLITPCWVLTAAHCF-------PTG 209

  Fly   190 RLLQLDRSSTHLG----------------VTRSVAFAHAHVGYDPVSLVHDIALLRLD----QPI 234
            :..|::|.|..||                |:|.|  .|....|...:..||||||:::    |..
Zfish   210 KRTQINRYSVVLGKNAINETDPVKEQKFTVSRLV--IHEDFDYSTENYTHDIALLKIEDCNGQCA 272

  Fly   235 PLVDTMRPACLPSNWLQNFDFQKAI-------VAGWGLSQEGG-STSSVLQEVVVPIITNAQCRA 291
            ....|:|.||||       .||:.:       :||:|..|:|. ..|..|::..|.:|:...|:.
Zfish   273 VKTKTVRTACLP-------PFQQMLPVGFYCEIAGYGRYQKGTFKFSRYLKQTEVKLISQKVCQR 330

  Fly   292 TSY-RSMIVDTMMCAGYVKTGGR----DACQGDSGGPLIVR-DRIFRLAGVVSFGYGCAKPDAPG 350
            |.| :..:.:.|:||     .||    |||||||||||:.. :.|..|.|::|:|..||:.:.||
Zfish   331 TYYNKDEVNENMLCA-----NGRDWKTDACQGDSGGPLVCEVNNIMFLFGIISWGKECAEKNQPG 390

  Fly   351 VYTRVSRYLEWIAVNT 366
            |||:||.|.:||:.:|
Zfish   391 VYTQVSNYNQWISQHT 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 90/262 (34%)
Tryp_SPc 137..362 CDD:238113 89/258 (34%)
plauaXP_017214157.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.