Sequence 1: | NP_648706.2 | Gene: | CG9592 / 39585 | FlyBaseID: | FBgn0036426 | Length: | 152 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_011927.1 | Gene: | VMA22 / 856457 | SGDID: | S000001102 | Length: | 181 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 137 | Identity: | 33/137 - (24%) |
---|---|---|---|
Similarity: | 49/137 - (35%) | Gaps: | 42/137 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 QLIEDLELLHSQVNKESCRAQLVLARVRLHQGFERIPAEAQLPRGRPY-KALTRVVENDNYWGKV 66
Fly 67 FKMIRLPVNPILGYLLPVRNIFGCLVSDNLRIANRHWDNCLDLVVECANVQRKLQSTINSIENLR 131
Fly 132 NLLNQRQ 138 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0005685 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR31996 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
3 | 3.060 |