DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9592 and VMA22

DIOPT Version :9

Sequence 1:NP_648706.2 Gene:CG9592 / 39585 FlyBaseID:FBgn0036426 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_011927.1 Gene:VMA22 / 856457 SGDID:S000001102 Length:181 Species:Saccharomyces cerevisiae


Alignment Length:137 Identity:33/137 - (24%)
Similarity:49/137 - (35%) Gaps:42/137 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QLIEDLELLHSQVNKESCRAQLVLARVRLHQGFERIPAEAQLPRGRPY-KALTRVVENDNYWGKV 66
            |.:..:|||.   |.:|...|       |.:||:  ....||.|...| |...|....::||.:.
Yeast    16 QYLRLIELLS---NYDSTLEQ-------LQKGFQ--DGYIQLSRSNYYNKDSLRGNYGEDYWDET 68

  Fly    67 FKMIRLPVNPILGYLLPVRNIFGCLVSDNLRIANRHWDNCLDLVVECANVQRKLQSTINSIENLR 131
            :          :|.|:      ..:...|.::           |||.  |:||.|......|...
Yeast    69 Y----------IGQLM------ATVEEKNSKV-----------VVEI--VKRKAQDKQEKKEEED 104

  Fly   132 NLLNQRQ 138
            |.|.||:
Yeast   105 NKLTQRK 111



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005685
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR31996
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
33.060

Return to query results.
Submit another query.