DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9592 and AT1G20770

DIOPT Version :9

Sequence 1:NP_648706.2 Gene:CG9592 / 39585 FlyBaseID:FBgn0036426 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_173500.1 Gene:AT1G20770 / 838667 AraportID:AT1G20770 Length:215 Species:Arabidopsis thaliana


Alignment Length:180 Identity:38/180 - (21%)
Similarity:64/180 - (35%) Gaps:53/180 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIQLIEDLE---LLHSQVNKESCRAQLVLARVRLHQGFERIPAEAQLPRGRPYKALTRVVEND-- 60
            ::|.::.|:   .|...||.:.......||..|...|..||.:.....:..|..:..:|.:.|  
plant    33 VLQFLDSLDGYLTLMDSVNSKLREGWFDLASARHSMGTLRINSTLLDLKYHPASSTLQVTDQDVE 97

  Fly    61 ----------NYW--------GKVFKM-----IRLPVNPILGY--------------LLPV---- 84
                      :.|        ||.|..     |..|::|.|.:              :|..    
plant    98 SLGSVPHFALSKWASKGGSRKGKDFSTDTDSEIGSPLSPQLRHRGVSEEKPSAKDETVLAADEEI 162

  Fly    85 -------RNIFGCLVSDNLRIANRHWDNCLDLVVECANVQRKLQSTINSI 127
                   .::||.|||..||.|.:.::..|:.:||.||::..:.|....|
plant   163 KKERAKSLSVFGGLVSPKLRGAQQSFETALETLVEIANMRASMISAFERI 212



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005685
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR31996
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
33.060

Return to query results.
Submit another query.